Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCarbonic Anhydrase VB
LigandBDBM25897
Substrate/CompetitorBDBM10856
Meas. Tech.CA Inhibition Assay
Ki 429±n/a nM
Citation Temperini CCecchi AScozzafava ASupuran CT Carbonic anhydrase inhibitors. Interaction of indapamide and related diuretics with 12 mammalian isozymes and X-ray crystallographic studies for the indapamide-isozyme II adduct. Bioorg Med Chem Lett 18:2567-73 (2008) [PubMed]  Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Carbonic Anhydrase VB
Name:Carbonic Anhydrase VB
Synonyms:CA-VB | Carbonate dehydratase VB | Carbonic anhydrase 5B (CA VB) | Carbonic anhydrase 5B, mitochondrial | Carbonic anhydrase 5B, mitochondrial precursor | Carbonic anhydrase VB (CA VB)
Type:Enzyme
Mol. Mass.:36440.83
Organism:Homo sapiens (Human)
Description:Human (cloned) isozyme
Residue:317
Sequence:
MVVMNSLRVILQASPGKLLWRKFQIPRFMPARPCSLYTCTYKTRNRALHPLWESVDLVPG
GDRQSPINIRWRDSVYDPGLKPLTISYDPATCLHVWNNGYSFLVEFEDSTDKSVIKGGPL
EHNYRLKQFHFHWGAIDAWGSEHTVDSKCFPAELHLVHWNAVRFENFEDAALEENGLAVI
GVFLKLGKHHKELQKLVDTLPSIKHKDALVEFGSFDPSCLMPTCPDYWTYSGSLTTPPLS
ESVTWIIKKQPVEVDHDQLEQFRTLLFTSEGEKEKRMVDNFRPLQPLMNRTVRSSFRHDY
VLNVQAKPKPATSQATP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM25897
BDBM10856
NameBDBM25897
Synonyms:1,1-dioxo-6-(trifluoromethyl)-3,4-dihydro-2H-1,2,4-benzothiadiazine-7-sulfonamide | BMCL182567 Compound 6b | Diuredemina | Glomerulin | Hydroflumethiazide | cid_3647
TypeSmall organic molecule
Emp. Form.C8H8F3N3O4S2
Mol. Mass.331.292
SMILESNS(=O)(=O)c1cc2c(NCNS2(=O)=O)cc1C(F)(F)F
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: