Reaction Details |
| Report a problem with these data |
Target | Carbonic anhydrase 13 |
---|
Ligand | BDBM13076 |
---|
Substrate/Competitor | BDBM10856 |
---|
Meas. Tech. | CA Inhibition Assay |
---|
Ki | 3885±n/a nM |
---|
Citation | Temperini, C; Cecchi, A; Scozzafava, A; Supuran, CT Carbonic anhydrase inhibitors. Interaction of indapamide and related diuretics with 12 mammalian isozymes and X-ray crystallographic studies for the indapamide-isozyme II adduct. Bioorg Med Chem Lett18:2567-73 (2008) [PubMed] Article |
---|
More Info.: | Get all data from this article, Solution Info, Assay Method |
---|
|
Carbonic anhydrase 13 |
---|
Name: | Carbonic anhydrase 13 |
Synonyms: | CA-XIII | CAH13_MOUSE | Ca13 | Car13 | Carbonate dehydratase XIII | Carbonic anhydrase 13 | Carbonic anhydrase XIII |
Type: | Enzyme |
Mol. Mass.: | 29522.80 |
Organism: | Mus musculus (mouse) |
Description: | Murine cloned isozyme |
Residue: | 262 |
Sequence: | MARLSWGYGEHNGPIHWNELFPIADGDQQSPIEIKTKEVKYDSSLRPLSIKYDPASAKII
SNSGHSFNVDFDDTEDKSVLRGGPLTGNYRLRQFHLHWGSADDHGSEHVVDGVRYAAELH
VVHWNSDKYPSFVEAAHESDGLAVLGVFLQIGEHNPQLQKITDILDSIKEKGKQTRFTNF
DPLCLLPSSWDYWTYPGSLTVPPLLESVTWIVLKQPISISSQQLARFRSLLCTAEGESAA
FLLSNHRPPQPLKGRRVRASFY
|
|
|
BDBM13076 |
---|
BDBM10856 |
---|
Name | BDBM13076 |
Synonyms: | 6-chloro-1,1-dioxo-3,4-dihydro-2H-1,2,4-benzothiadiazine-7-sulfonamide | BMCL182567 Compound 6a | Dichlothiazide | Hydro-D | Hydrochlorothiazide | Hypothiazide | JFD00715 | Oretic | cid_3639 |
Type | Small organic molecule |
Emp. Form. | C7H8ClN3O4S2 |
Mol. Mass. | 297.739 |
SMILES | NS(=O)(=O)c1cc2c(NCNS2(=O)=O)cc1Cl |
Structure |
|