Reaction Details |
| Report a problem with these data |
Target | Carbonic anhydrase 13 |
---|
Ligand | BDBM25902 |
---|
Substrate/Competitor | BDBM10856 |
---|
Meas. Tech. | CA Inhibition Assay |
---|
Ki | 550±n/a nM |
---|
Citation | Temperini, C; Cecchi, A; Scozzafava, A; Supuran, CT Carbonic anhydrase inhibitors. Interaction of indapamide and related diuretics with 12 mammalian isozymes and X-ray crystallographic studies for the indapamide-isozyme II adduct. Bioorg Med Chem Lett18:2567-73 (2008) [PubMed] Article |
---|
More Info.: | Get all data from this article, Solution Info, Assay Method |
---|
|
Carbonic anhydrase 13 |
---|
Name: | Carbonic anhydrase 13 |
Synonyms: | CA-XIII | CAH13_MOUSE | Ca13 | Car13 | Carbonate dehydratase XIII | Carbonic anhydrase 13 | Carbonic anhydrase XIII |
Type: | Enzyme |
Mol. Mass.: | 29522.80 |
Organism: | Mus musculus (mouse) |
Description: | Murine cloned isozyme |
Residue: | 262 |
Sequence: | MARLSWGYGEHNGPIHWNELFPIADGDQQSPIEIKTKEVKYDSSLRPLSIKYDPASAKII
SNSGHSFNVDFDDTEDKSVLRGGPLTGNYRLRQFHLHWGSADDHGSEHVVDGVRYAAELH
VVHWNSDKYPSFVEAAHESDGLAVLGVFLQIGEHNPQLQKITDILDSIKEKGKQTRFTNF
DPLCLLPSSWDYWTYPGSLTVPPLLESVTWIVLKQPISISSQQLARFRSLLCTAEGESAA
FLLSNHRPPQPLKGRRVRASFY
|
|
|
BDBM25902 |
---|
BDBM10856 |
---|
Name | BDBM25902 |
Synonyms: | 4-chloro-2-[(furan-2-ylmethyl)amino]-5-sulfamoylbenzoic acid | CHEMBL35 | Frusemide | Furanthril | Furosemide | Furosemide (3) | Furosemide, 4 | Lasix | US10172837, Furosemide |
Type | Small organic molecule |
Emp. Form. | C12H11ClN2O5S |
Mol. Mass. | 330.744 |
SMILES | NS(=O)(=O)c1cc(C(O)=O)c(NCc2ccco2)cc1Cl |
Structure |
|