new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetTyrosine-protein kinase TXK
LigandBDBM384539
Substrate/Competitorn/a
Meas. Tech.Enzymatic Activity In Vitro Assays
IC50 0.200±n/a nM
Citation Owens THill RJ Benzimidazole derivatives as RLK and ITK inhibitors US Patent  US9932329 Publication Date 4/3/2018  Article
More Info.:Get all data from this article,  Assay Method
 
Tyrosine-protein kinase TXK
Name:Tyrosine-protein kinase TXK
Synonyms:PTK4 | Protein-tyrosine kinase 4 | RLK | Resting lymphocyte kinase | TXK | Tyrosine-protein kinase TXK (TXK)
Type:Protein
Mol. Mass.:61268.80
Organism:Homo sapiens (Human)
Description:P42681
Residue:527
Sequence:
MILSSYNTIQSVFCCCCCCSVQKRQMRTQISLSTDEELPEKYTQRRRPWLSQLSNKKQSN
TGRVQPSKRKPLPPLPPSEVAEEKIQVKALYDFLPREPCNLALRRAEEYLILEKYNPHWW
KARDRLGNEGLIPSNYVTENKITNLEIYEWYHRNITRNQAEHLLRQESKEGAFIVRDSRH
LGSYTISVFMGARRSTEAAIKHYQIKKNDSGQWYVAERHAFQSIPELIWYHQHNAAGLMT
RLRYPVGLMGSCLPATAGFSYEKWEIDPSELAFIKEIGSGQFGVVHLGEWRSHIQVAIKA
INEGSMSEEDFIEEAKVMMKLSHSKLVQLYGVCIQRKPLYIVTEFMENGCLLNYLRENKG
KLRKEMLLSVCQDICEGMEYLERNGYIHRDLAARNCLVSSTCIVKISDFGMTRYVLDDEY
VSSFGAKFPIKWSPPEVFLFNKYSSKSDVWSFGVLMWEVFTEGKMPFENKSNLQVVEAIS
EGFRLYRPHLAPMSIYEVMYSCWHEKPEGRPTFAELLRAVTEIAETW
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM384539
n/a
NameBDBM384539
Synonyms:N-(1-(((R)-1-acryloylpyrrolidin-2-yl)methyl)-5-((((S)-1-hydroxy-3,3-dimethylbutan-2-yl)-amino)methyl)-1H-benzo[d]imidazol-2-yl)-5-(oxazol-5-yl)thiophene-2-carboxamide | US9932329, Cpd # 10
TypeSmall organic molecule
Emp. Form.C30H36N6O4S
Mol. Mass.576.71
SMILESCC(C)(C)[C@@H](CO)NCc1ccc2n(C[C@H]3CCCN3C(=O)C=C)c(NC(=O)c3ccc(s3)-c3cnco3)nc2c1 |r|
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: