Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCaspase-1
LigandBDBM10246
Substrate/CompetitorCaspase-7 Fluorometric Substrate Ac-Asp-Glu-Val-Asp-AFC
Meas. Tech.Fluorometric Assay
pH7.5±n/a
Temperature298.15±n/a K
Ki 18±n/a nM
Citation Garcia-Calvo MPeterson EPLeiting BRuel RNicholson DWThornberry NA Inhibition of human caspases by peptide-based and macromolecular inhibitors. J Biol Chem 273:32608-13 (1998) [PubMed]  Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Caspase-1
Name:Caspase
Synonyms:Caspase 1 | ICE | Interleukin-1 beta convertase | Interleukin-1 beta-converting enzyme
Type:Enzyme
Mol. Mass.:45154.13
Organism:Homo sapiens (Human)
Description:P29466
Residue:404
Sequence:
MADKVLKEKRKLFIRSMGEGTINGLLDELLQTRVLNKEEMEKVKRENATVMDKTRALIDS
VIPKGAQACQICITYICEEDSYLAGTLGLSADQTSGNYLNMQDSQGVLSSFPAPQAVQDN
PAMPTSSGSEGNVKLCSLEEAQRIWKQKSAEIYPIMDKSSRTRLALIICNEEFDSIPRRT
GAEVDITGMTMLLQNLGYSVDVKKNLTASDMTTELEAFAHRPEHKTSDSTFLVFMSHGIR
EGICGKKHSEQVPDILQLNAIFNMLNTKNCPSLKDKPKVIIIQACRGDSPGVVWFKDSVG
VSGNLSLPTTEEFEDDAIKKAHIEKDFIAFCSSTPDNVSWRHPTMGSVFIGRLIEHMQEY
ACSCDVEEIFRKVRFSFEQPDGRAQMPTTERVTLTRCFYLFPGH
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM10246
Caspase-7 Fluorometric Substrate Ac-Asp-Glu-Val-Asp-AFC
Name:Caspase-7 Fluorometric Substrate Ac-Asp-Glu-Val-Asp-AFC
Synonyms:Ac-DEVD-AFC | Ac-DEVD-AMC | Fluorometric Tetrapeptide Ac-DEVD-AMC
Type:Peptide
Mol. Mass.:473.41
Organism:n/a
Description:Molecular Mass of DEVD
Residue:4
Sequence:
DEVD