Reaction Details |
| Report a problem with these data |
Target | Epidermal growth factor receptor [696-1022,T790M] |
---|
Ligand | BDBM5447 |
---|
Substrate/Competitor | BDBM10852 |
---|
Meas. Tech. | Fluorescence Binding Assay |
---|
pH | 7.4±n/a |
---|
Temperature | 295.15±n/a K |
---|
Kd | 4.6±.1 nM |
---|
Citation | Yun, CH; Mengwasser, KE; Toms, AV; Woo, MS; Greulich, H; Wong, KK; Meyerson, M; Eck, MJ The T790M mutation in EGFR kinase causes drug resistance by increasing the affinity for ATP. Proc Natl Acad Sci U S A105:2070-5 (2008) [PubMed] Article |
---|
More Info.: | Get all data from this article, Solution Info, Assay Method |
---|
|
Epidermal growth factor receptor [696-1022,T790M] |
---|
Name: | Epidermal growth factor receptor [696-1022,T790M] |
Synonyms: | EGF-R Tyrosine Kinase Mutant (T790M) | EGFR | EGFR_HUMAN | ERBB | ERBB1 | HER1 |
Type: | Tyrosine-protein kinase |
Mol. Mass.: | 37282.81 |
Organism: | Homo sapiens (Human) |
Description: | P00533[696-1022,T790M] |
Residue: | 327 |
Sequence: | GEAPNQALLRILKETEFKKIKVLGSGAFGTVYKGLWIPEGEKVKIPVAIKELREATSPKA
NKEILDEAYVMASVDNPHVCRLLGICLTSTVQLIMQLMPFGCLLDYVREHKDNIGSQYLL
NWCVQIAKGMNYLEDRRLVHRDLAARNVLVKTPQHVKITDFGLAKLLGAEEKEYHAEGGK
VPIKWMALESILHRIYTHQSDVWSYGVTVWELMTFGSKPYDGIPASEISSILEKGERLPQ
PPICTIDVYMIMVKCWMIDADSRPKFRELIIEFSKMARDPQRYLVIQGDERMHLPSPTDS
NFYRALMDEEDMDDVVDADEYLIPQQG
|
|
|
BDBM5447 |
---|
BDBM10852 |
---|
Name | BDBM5447 |
Synonyms: | CHEMBL939 | GEFITINIB | Iressa | N-(3-Chloro-4-fluorophenyl)-7-methoxy-6-[3-(4-morpholinyl)propoxy]-4-quinazolinamine | N-(3-chloro-4-fluorophenyl)-7-methoxy-6-[3-(morpholin-4-yl)propoxy]quinazolin-4-amine | US10106508, Gefitinib | US10507209, Compound Gefitinib | US9416123, Gefitinib | US9730934, Gefitinib | US9783524, Gefitinib | WO2022090481, Example gefitinib | ZD1839 | cid_123631 |
Type | Small organic molecule |
Emp. Form. | C22H24ClFN4O3 |
Mol. Mass. | 446.902 |
SMILES | COc1cc2ncnc(Nc3ccc(F)c(Cl)c3)c2cc1OCCCN1CCOCC1 |
Structure |
|