Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHistone Lysine Demethylase
LigandBDBM26109
Substrate/CompetitorHistone H3 fragment substrate
Meas. Tech.FDH Coupled Inhibition Assay
pH7.5±n/a
Temperature310.15±n/a K
IC50>10000000±n/a nM
Citation Rose NRNg SSMecinovic; JLiénard MRBello SHSun ZMcDonough MAOppermann USchofield CJ Inhibitor Scaffolds for 2-Oxoglutarate-Dependent Histone Lysine Demethylases. J Med Chem 51:7053-6 (2008) [PubMed]  Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Histone Lysine Demethylase
Name:Histone Lysine Demethylase
Synonyms:2-OG-Dependent Histone Demethylase JMJD2E | Jumonji domain-containing protein 2E (JMJD2E) | KDM4D-like protein | Lysine-specific demethylase 4D-like | Lysine-specific demethylase 4E | Lysine-specific demethylase 4E (KDM4E)
Type:Enzyme
Mol. Mass.:56815.71
Organism:Homo sapiens (Human)
Description:B2RXH2
Residue:506
Sequence:
MKSVHSSPQNTSHTIMTFYPTMEEFADFNTYVAYMESQGAHQAGLAKVIPPKEWKARQMY
DDIEDILIATPLQQVTSGQGGVFTQYHKKKKAMRVGQYRRLANSKKYQTPPHQNFADLEQ
RYWKSHPGNPPIYGADISGSLFEESTKQWNLGHLGTILDLLEQECGVVIEGVNTPYLYFG
MWKTTFAWHTEDMDLYSINYLHFGEPKTWYVVPPEHGQHLERLARELFPDISRGCEAFLR
HKVALISPTVLKENGIPFNCMTQEAGEFMVTFPYGYHAGFNHGFNCAEAINFATPRWIDY
GKMASQCSCGESTVTFSMDPFVRIVQPESYELWKHRQDLAIVEHTEPRVAESQELSNWRD
DIVLRRAALGLRLLPNLTAQCPTQPVSSGHCYNPKGCGTDAVPGSAFQSSAYHTQTQSLT
LGMSARVLLPSTGSWGSGRGRGRGQGQGRGCSRGRGHGCCTRELGTEEPTVQPASKRRLL
MGTRSRAQGHRPQLPLANDLMTNLSL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM26109
Histone H3 fragment substrate
Name:Histone H3 fragment substrate
Synonyms:H3K9me3
Type:8-mer
Mol. Mass.:1066.23
Organism:n/a
Description:2-OG as co-substrate.
Residue:10
Sequence:
ARKme3STGGK