| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Metallo-beta-lactamase type 2 |
|---|
| Ligand | BDBM262935 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Class B Enzyme Assay |
|---|
| pH | 7±n/a |
|---|
| IC50 | 0.438±n/a nM |
|---|
| Comments | extracted |
|---|
| Citation |  Mandal, M; Tang, H; Xiao, L; Su, J; Li, G; Yang, S; Pan, W; Tang, H; DeJesus, R; Hicks, J; Lombardo, M; Chu, H; Hagmann, W; Pasternak, A; Gu, X; Jiang, J; Dong, S; Ding, F; London, C; Biswas, D; Young, K; Hunter, DN; Zhao, Z; Yang, D Metallo-beta-lactamase inhibitors US Patent US9708336 Publication Date 7/18/2017 |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Metallo-beta-lactamase type 2 |
|---|
| Name: | Metallo-beta-lactamase type 2 |
|---|
| Synonyms: | B2 metallo-beta-lactamase | BLA-IMP | BLAB_SERMA | Beta-lactamase type II | IMP-1 | Metallo-beta-lactamase type II |
|---|
| Type: | undefined |
|---|
| Mol. Mass.: | 27125.88 |
|---|
| Organism: | Serratia marcescens |
|---|
| Description: | P52699 |
|---|
| Residue: | 246 |
|---|
| Sequence: | MSKLSVFFIFLFCSIATAAESLPDLKIEKLDEGVYVHTSFEEVNGWGVVPKHGLVVLVNA
EAYLIDTPFTAKDTEKLVTWFVERGYKIKGSISSHFHSDSTGGIEWLNSRSIPTYASELT
NELLKKDGKVQATNSFSGVNYWLVKNKIEVFYPGPGHTPDNVVVWLPERKILFGGCFIKP
YGLGNLGDANIEAWPKSAKLLKSKYGKAKLVVPSHSEVGDASLLKLTLEQAVKGLNESKK
PSKPSN
|
|
|
|---|
| BDBM262935 |
|---|
| n/a |
|---|
| Name | BDBM262935 |
|---|
| Synonyms: | 4'-[1-(7- azabicyclo[2.2.1]hept-2- yl)piperidin-4-yl]-2-(1H- tetrazol-5-yl)-4- (trifluoromethyl)biphenyl- 3-sulfonamide | US9708336, 788 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C25H28F3N7O2S |
|---|
| Mol. Mass. | 547.596 |
|---|
| SMILES | NS(=O)(=O)c1c(ccc(-c2ccc(cc2)C2CCN(CC2)C2CC3CCC2N3)c1-c1nnn[nH]1)C(F)(F)F |
|---|
| Structure | 
|
|---|
Search and Browse
