Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCarbonic Anhydrase III
LigandBDBM26190
Substrate/CompetitorBDBM10856
Meas. Tech.CA Inhibition Assay
pH7.4±n/a
Temperature298.15±n/a K
Ki 8200±n/a nM
Citation Innocenti AVullo DScozzafava ASupuran CT Carbonic anhydrase inhibitors: inhibition of mammalian isoforms I-XIV with a series of substituted phenols including paracetamol and salicylic acid. Bioorg Med Chem 16:7424-8 (2008) [PubMed]  Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Carbonic Anhydrase III
Name:Carbonic Anhydrase III
Synonyms:CA-III | Carbonate dehydratase III | Carbonic anhydrase 3 (CA III) | Carbonic anhydrase III (CA III)
Type:Enzyme
Mol. Mass.:29562.11
Organism:Homo sapiens (Human)
Description:Human cloned isozyme.
Residue:260
Sequence:
MAKEWGYASHNGPDHWHELFPNAKGENQSPVELHTKDIRHDPSLQPWSVSYDGGSAKTIL
NNGKTCRVVFDDTYDRSMLRGGPLPGPYRLRQFHLHWGSSDDHGSEHTVDGVKYAAELHL
VHWNPKYNTFKEALKQRDGIAVIGIFLKIGHENGEFQIFLDALDKIKTKGKEAPFTKFDP
SCLFPACRDYWTYQGSFTTPPCEECIVWLLLKEPMTVSSDQMAKLRSLLSSAENEPPVPL
VSNWRPPQPINNRVVRASFK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM26190
BDBM10856
NameBDBM26190
Synonyms:1,4-Dihydroxybenzene, XIII | 1,4-dihydroxybenzene | CHEMBL537 | Hydroquinone (9) | Hydroquinone, HQ | benzene-1,4-diol | phenol derivative, 4
TypeSmall organic molecule
Emp. Form.C6H6O2
Mol. Mass.110.1106
SMILESOc1ccc(O)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: