Reaction Details |
| Report a problem with these data |
Target | Baculoviral IAP repeat-containing protein 2 [253-363] |
---|
Ligand | BDBM26206 |
---|
Substrate/Competitor | Smac-derived peptide |
---|
Meas. Tech. | Fluorescence Polarization Assay |
---|
pH | 7.5±n/a |
---|
Temperature | 295.15±n/a K |
---|
Ki | 3.0±0.5 nM |
---|
Citation | Zhang, B; Nikolovska-Coleska, Z; Zhang, Y; Bai, L; Qiu, S; Yang, CY; Sun, H; Wang, S; Wu, Y Design, Synthesis, and Evaluation of Tricyclic, Conformationally Constrained Small-Molecule Mimetics of Second Mitochondria-Derived Activator of Caspases. J Med Chem51:7352-5 (2008) [PubMed] Article |
---|
More Info.: | Get all data from this article, Solution Info, Assay Method |
---|
|
Baculoviral IAP repeat-containing protein 2 [253-363] |
---|
Name: | Baculoviral IAP repeat-containing protein 2 [253-363] |
Synonyms: | API1 | BIRC2 | BIRC2_HUMAN | Baculoviral IAP repeat-containing protein 2 | HIAP-2 | IAP homolog B | Inhibitor of apoptosis protein 2 | MIHB | RING finger protein 48 | RNF48 | TNFR2-TRAF-signaling complex protein 2 | cIAP-1 BIR3 |
Type: | BIR3 domain |
Mol. Mass.: | 12929.05 |
Organism: | Homo sapiens (Human) |
Description: | Human cIAP1 BIR3 domain (residues 253-363) was used in binding assays. |
Residue: | 111 |
Sequence: | SLETLRFSISNLSMQTHAARMRTFMYWPSSVPVQPEQLASAGFYYVGRNDDVKCFCCDGG
LRCWESGDDPWVEHAKWFPRCEFLIRMKGQEFVDEIQGRYPHLLEQLLSTS
|
|
|
BDBM26206 |
---|
Smac-derived peptide |
---|
Name: | Smac-derived peptide |
Synonyms: | SM5F |
Type: | fluorescently labelled peptide |
Mol. Mass.: | 1220.95 |
Organism: | n/a |
Description: | 5-carboxyfluorescein was coupled to the lysine side chain of the mutated Smac peptide. |
Residue: | 10 |
Sequence: | |