Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Target20-alpha-Hydroxysteroid Dehydrogenase (AKR1C1) Mutant (L306A)
LigandBDBM26269
Substrate/CompetitorBDBM26270
Meas. Tech.Assay of Enzyme Activity
pH7.4±n/a
Temperature298.15±n/a K
Ki 270±29 nM
Citation Dhagat UEndo SSumii RHara AEl-Kabbani O Selectivity determinants of inhibitor binding to human 20alpha-hydroxysteroid dehydrogenase: crystal structure of the enzyme in ternary complex with coenzyme and the potent inhibitor 3,5-dichlorosalicylic acid. J Med Chem 51:4844-8 (2008) [PubMed]  Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
20-alpha-Hydroxysteroid Dehydrogenase (AKR1C1) Mutant (L306A)
Name:20-alpha-Hydroxysteroid Dehydrogenase (AKR1C1) Mutant (L306A)
Synonyms:n/a
Type:Enzyme
Mol. Mass.:36751.89
Organism:Homo sapiens (Human)
Description:n/a
Residue:323
Sequence:
MDSKYQCVKLNDGHFMPVLGFGTYAPAEVPKSKALEATKLAIEAGFRHIDSAHLYNNEEQ
VGLAIRSKIADGSVKREDIFYTSKLWCNSHRPELVRPALERSLKNLQLDYVDLYLIHFPV
SVKPGEEVIPKDENGKILFDTVDLCATWEAVEKCKDAGLAKSIGVSNFNRRQLEMILNKP
GLKYKPVCNQVECHPYFNQRKLLDFCKSKDIVLVAYSALGSHREEPWVDPNSPVLLEDPV
LCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTSEEMKAIDGLN
RNVRYATLDIFAGPPNYPFSDEY
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM26269
BDBM26270
NameBDBM26269
Synonyms:3,5-dichloro-2-hydroxybenzoic acid | 3,5-dichlorosalicylic acid | CHEMBL449129
TypeSmall organic molecule
Emp. Form.C7H4Cl2O3
Mol. Mass.207.011
SMILESOC(=O)c1cc(Cl)cc(Cl)c1O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: