| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Aldo-keto reductase family 1 member C1 [L306A] |
|---|
| Ligand | BDBM26269 |
|---|
| Substrate/Competitor | BDBM26270 |
|---|
| Meas. Tech. | Assay of Enzyme Activity |
|---|
| pH | 7.4±n/a |
|---|
| Temperature | 298.15±n/a K |
|---|
| Ki | 270±29 nM |
|---|
| Citation |  Dhagat, U; Endo, S; Sumii, R; Hara, A; El-Kabbani, O Selectivity determinants of inhibitor binding to human 20alpha-hydroxysteroid dehydrogenase: crystal structure of the enzyme in ternary complex with coenzyme and the potent inhibitor 3,5-dichlorosalicylic acid. J Med Chem51:4844-8 (2008) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Solution Info, Assay Method |
|---|
| |
| Aldo-keto reductase family 1 member C1 [L306A] |
|---|
| Name: | Aldo-keto reductase family 1 member C1 [L306A] |
|---|
| Synonyms: | 20-alpha-Hydroxysteroid Dehydrogenase (AKR1C1) Mutant (L306A) | AK1C1_HUMAN | AKR1C1 | DDH | DDH1 |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 36751.89 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | Q04828[L306A] |
|---|
| Residue: | 323 |
|---|
| Sequence: | MDSKYQCVKLNDGHFMPVLGFGTYAPAEVPKSKALEATKLAIEAGFRHIDSAHLYNNEEQ
VGLAIRSKIADGSVKREDIFYTSKLWCNSHRPELVRPALERSLKNLQLDYVDLYLIHFPV
SVKPGEEVIPKDENGKILFDTVDLCATWEAVEKCKDAGLAKSIGVSNFNRRQLEMILNKP
GLKYKPVCNQVECHPYFNQRKLLDFCKSKDIVLVAYSALGSHREEPWVDPNSPVLLEDPV
LCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTSEEMKAIDGLN
RNVRYATLDIFAGPPNYPFSDEY
|
|
|
|---|
| BDBM26269 |
|---|
| BDBM26270 |
|---|
| Name | BDBM26269 |
|---|
| Synonyms: | 3,5-dichloro-2-hydroxybenzoic acid | 3,5-dichlorosalicylic acid | CHEMBL449129 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C7H4Cl2O3 |
|---|
| Mol. Mass. | 207.011 |
|---|
| SMILES | OC(=O)c1cc(Cl)cc(Cl)c1O |
|---|
| Structure | 
|
|---|
Search and Browse
