Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAurora kinase B
LigandBDBM26315
Substrate/CompetitorFAM-PKAtide
Meas. Tech.Aurora Kinase Assay
IC50 14±n/a nM
Citation Oslob JDRomanowski MJAllen DABaskaran SBui MElling RAFlanagan WMFung ADHanan EJHarris SHeumann SAHoch UJacobs JWLam JLawrence CEMcDowell RSNannini MAShen WSilverman JASopko MMTangonan BTTeague JYoburn JCYu CHZhong MZimmerman KMO'Brien TLew W Discovery of a potent and selective aurora kinase inhibitor. Bioorg Med Chem Lett 18:4880-4 (2008) [PubMed]  Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Aurora kinase B
Name:Aurora kinase B
Synonyms:AIM-1 | Aurora B kinase (aurB) | Aurora B-INCENP | Aurora kinase 2 | Aurora kinase B (AURKB) | Aurora-related kinase 2 | STK-1 | Serine/threonine-protein kinase aurora B
Type:Protein
Mol. Mass.:39327.72
Organism:Homo sapiens (Human)
Description:Q96GD4
Residue:344
Sequence:
MAQKENSYPWPYGRQTAPSGLSTLPQRVLRKEPVTPSALVLMSRSNVQPTAAPGQKVMEN
SSGTPDILTRHFTIDDFEIGRPLGKGKFGNVYLAREKKSHFIVALKVLFKSQIEKEGVEH
QLRREIEIQAHLHHPNILRLYNYFYDRRRIYLILEYAPRGELYKELQKSCTFDEQRTATI
MEELADALMYCHGKKVIHRDIKPENLLLGLKGELKIADFGWSVHAPSLRRKTMCGTLDYL
PPEMIEGRMHNEKVDLWCIGVLCYELLVGNPPFESASHNETYRRIVKVDLKFPASVPMGA
QDLISKLLRHNPSERLPLAQVSAHPWVRANSRRVLPPSALQSVA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM26315
FAM-PKAtide
Name:FAM-PKAtide
Synonyms:n/a
Type:fluorescien-labeled peptide
Mol. Mass.:1620.33
Organism:n/a
Description:n/a
Residue:14
Sequence:
5FAM-GRTGRRNSI-NH2