Reaction Details |
| Report a problem with these data |
Target | Histamine H4 receptor |
---|
Ligand | BDBM26400 |
---|
Substrate/Competitor | BDBM7966 |
---|
Meas. Tech. | Radioligand Binding Assay |
---|
pH | 7.4±n/a |
---|
Temperature | 298.15±n/a K |
---|
Ki | 4.5±0.55 nM |
---|
Citation | Cowart, MD; Altenbach, RJ; Liu, H; Hsieh, GC; Drizin, I; Milicic, I; Miller, TR; Witte, DG; Wishart, N; Fix-Stenzel, SR; McPherson, MJ; Adair, RM; Wetter, JM; Bettencourt, BM; Marsh, KC; Sullivan, JP; Honore, P; Esbenshade, TA; Brioni, JD Rotationally constrained 2,4-diamino-5,6-disubstituted pyrimidines: a new class of histamine H4 receptor antagonists with improved druglikeness and in vivo efficacy in pain and inflammation models. J Med Chem51:6547-57 (2008) [PubMed] Article |
---|
More Info.: | Get all data from this article, Solution Info, Assay Method |
---|
|
Histamine H4 receptor |
---|
Name: | Histamine H4 receptor |
Synonyms: | HH4R | HRH4_RAT | Hrh4 |
Type: | G Protein-Coupled Receptor (GPCR) |
Mol. Mass.: | 44045.07 |
Organism: | Rattus norvegicus (rat) |
Description: | Cell pellets from SK-N-MC cells transfected with rat H4 receptor were used in binding assay. |
Residue: | 391 |
Sequence: | MSESNGTDVLPLTAQVPLAFLMSLLAFAITIGNAVVILAFVADRNLRHRSNYFFLNLAIS
DFFVGVISIPLYIPHTLFNWNFGSGICMFWLITDYLLCTASVYSIVLISYDRYQSVSNAV
RYRAQHTGILKIVAQMVAVWILAFLVNGPMILASDSWKNSTNTEECEPGFVTEWYILAIT
AFLEFLLPVSLVVYFSVQIYWSLWKRGSLSRCPSHAGFIATSSRGTGHSRRTGLACRTSL
PGLKEPAASLHSESPRGKSSLLVSLRTHMSGSIIAFKVGSFCRSESPVLHQREHVELLRG
RKLARSLAVLLSAFAICWAPYCLFTIVLSTYRRGERPKSIWYSIAFWLQWFNSLINPFLY
PLCHRRFQKAFWKILCVTKQPAPSQTQSVSS
|
|
|
BDBM26400 |
---|
BDBM7966 |
---|
Name | BDBM26400 |
Synonyms: | 2,4-diamino-5,6-disubstituted pyrimidine, 14 | 9-phenyl-4-(piperazin-1-yl)-5H,6H,7H,8H,9H-cyclohepta[d]pyrimidin-2-amine |
Type | Small organic molecule |
Emp. Form. | C19H25N5 |
Mol. Mass. | 323.4353 |
SMILES | Nc1nc2C(CCCCc2c(n1)N1CCNCC1)c1ccccc1 |
Structure |
|