Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetTNF-alpha-Converting Enzyme
LigandBDBM23487
Substrate/CompetitorTACE substrate peptide
Meas. Tech.TACE Inhibition Assay
pH7.3±n/a
Temperature295.15±n/a K
Ki 3±n/a nM
Citation Guo ZOrth PWong SCLavey BJShih NYNiu XLundell DJMadison VKozlowski JA Discovery of novel spirocyclopropyl hydroxamate and carboxylate compounds as TACE inhibitors. Bioorg Med Chem Lett 19:54-7 (2009) [PubMed]  Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
TNF-alpha-Converting Enzyme
Name:TNF-alpha-Converting Enzyme
Synonyms:A disintegrin and metalloproteinase domain 17 | ADAM 17 | CD156b antigen | Snake venom-like protease
Type:Single-pass type I membrane protein; metalloprotease
Mol. Mass.:29695.98
Organism:Homo sapiens (Human)
Description:The catalytic domain of recombinant human TNF-converting enzyme (residues 215-477) with two mutations (S266A and N452Q) and a 6xHis was purified from the baculovirus/Hi5 cells expression system.
Residue:263
Sequence:
RADPDPMKNTCKLLVVADHRFYRYMGRGEESTTTNYLIELIDRVDDIYRNTAWDNAGFKG
YGIQIEQIRILKSPQEVKPGEKHYNMAKSYPNEEKDAWDVKMLLEQFSFDIAEEASKVCL
AHLFTYQDFDMGTLGLAYVGSPRANSHGGVCPKAYYSPVGKKNIYLNSGLTSTKNYGKTI
LTKEADLVTTHELGHNFGAEHDPDGLAECAPNEDQGGKYVMYPIAVSGDHENNKMFSQCS
KQSIYKTIESKAQECFQERSNKV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM23487
TACE substrate peptide
Name:TACE substrate peptide
Synonyms:n/a
Type:Internally quenched peptide
Mol. Mass.:4119.10
Organism:n/a
Description:MCA, (7-methoxycoumarin-4-yl)acetyl. Dpa, N-3-(2,4-dinitrophenyl)-L-2,3-diaminopropionyl.
Residue:39
Sequence:
MCA-Pro-Leu-Ala-Gln-Ala-Val-Arg-Ser-Ser-Ser-Dpa-Arg-NH2