Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetProstaglandin E2 receptor EP2 subtype
LigandBDBM263346
Substrate/CompetitorProstaglandin E2 receptor EP4 subtype (EP4)
Meas. Tech.FLIPR Assay
pH7.4±n/a
Ki 0.3±n/a nM
EC50 11±n/a nM
Commentsextracted
Citation Donde YNguyen JH Compounds and methods for skin repair US Patent  US9546162 Publication Date 1/17/2017
More Info.:Get all data from this article,  Assay Method
 
Prostaglandin E2 receptor EP2 subtype
Name:Prostaglandin E2 receptor
Synonyms:PGE receptor EP2 subtype | PTGER2 | Prostaglandin E2 | Prostanoid EP2 Receptor
Type:Enzyme
Mol. Mass.:39775.71
Organism:Homo sapiens (Human)
Description:P43116
Residue:358
Sequence:
MGNASNDSQSEDCETRQWLPPGESPAISSVMFSAGVLGNLIALALLARRWRGDVGCSAGR
RSSLSLFHVLVTELVFTDLLGTCLISPVVLASYARNQTLVALAPESRACTYFAFAMTFFS
LATMLMLFAMALERYLSIGHPYFYQRRVSRSGGLAVLPVIYAVSLLFCSLPLLDYGQYVQ
YCPGTWCFIRHGRTAYLQLYATLLLLLIVSVLACNFSVILNLIRMHRRSRRSRCGPSLGS
GRGGPGARRRGERVSMAEETDHLILLAIMTITFAVCSLPFTIFAYMNETSSRKEKWDLQA
LRFLSINSIIDPWVFAILRPPVLRLMRSVLCCRISLRTQDATQTSCSTQSDASKQADL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM263346
Prostaglandin E2 receptor EP4 subtype (EP4)
Name:Prostaglandin E2 receptor
Synonyms:PGE receptor EP4 subtype | PGE2 receptor EP4 subtype | PTGER2 | PTGER4 | Prostanoid EP4 receptor
Type:Enzyme
Mol. Mass.:53134.53
Organism:Homo sapiens (Human)
Description:P35408
Residue:488
Sequence:
MSTPGVNSSASLSPDRLNSPVTIPAVMFIFGVVGNLVAIVVLCKSRKEQKETTFYTLVCG
LAVTDLLGTLLVSPVTIATYMKGQWPGGQPLCEYSTFILLFFSLSGLSIICAMSVERYLA
INHAYFYSHYVDKRLAGLTLFAVYASNVLFCALPNMGLGSSRLQYPDTWCFIDWTTNVTA
HAAYSYMYAGFSSFLILATVLCNVLVCGALLRMHRQFMRRTSLGTEQHHAAAAASVASRG
HPAASPALPRLSDFRRRRSFRRIAGAEIQMVILLIATSLVVLICSIPLVVRVFVNQLYQP
SLEREVSKNPDLQAIRIASVNPILDPWIYILLRKTVLSKAIEKIKCLFCRIGGSRRERSG
QHCSDSQRTSSAMSGHSRSFISRELKEISSTSQTLLPDLSLPDLSENGLGGRNLLPGVPG
MGLAQEDTTSLRTLRISETSDSSQGQDSESVLLVDEAGGSGRAGPAPKGSSLQVTFPSET
LNLSEKCI
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff: