Reaction Details |
| Report a problem with these data |
Target | Serine/threonine-protein kinase pim-2 |
---|
Ligand | BDBM26701 |
---|
Substrate/Competitor | Biotinylated Substrate Peptide |
---|
Meas. Tech. | Pim Kinase Assay |
---|
pH | 7.5±n/a |
---|
Temperature | 295.15±n/a K |
---|
Ki | >1424±n/a nM |
---|
Citation | Tong, Y; Stewart, KD; Thomas, S; Przytulinska, M; Johnson, EF; Klinghofer, V; Leverson, J; McCall, O; Soni, NB; Luo, Y; Lin, NH; Sowin, TJ; Giranda, VL; Penning, TD Isoxazolo[3,4-b]quinoline-3,4(1H,9H)-diones as unique, potent and selective inhibitors for Pim-1 and Pim-2 kinases: chemistry, biological activities, and molecular modeling. Bioorg Med Chem Lett18:5206-8 (2008) [PubMed] Article |
---|
More Info.: | Get all data from this article, Inhibition_Run data, Solution Info, Assay Method |
---|
|
Serine/threonine-protein kinase pim-2 |
---|
Name: | Serine/threonine-protein kinase pim-2 |
Synonyms: | PIM2 | PIM2_HUMAN | Pim-2h | Serine/threonine-protein kinase (PIM2) | Serine/threonine-protein kinase PIM | Serine/threonine-protein kinase pim-2 (PIM2) |
Type: | Serine/threonine-protein kinase |
Mol. Mass.: | 34185.93 |
Organism: | Homo sapiens (Human) |
Description: | Q9P1W9 |
Residue: | 311 |
Sequence: | MLTKPLQGPPAPPGTPTPPPGGKDREAFEAEYRLGPLLGKGGFGTVFAGHRLTDRLQVAI
KVIPRNRVLGWSPLSDSVTCPLEVALLWKVGAGGGHPGVIRLLDWFETQEGFMLVLERPL
PAQDLFDYITEKGPLGEGPSRCFFGQVVAAIQHCHSRGVVHRDIKDENILIDLRRGCAKL
IDFGSGALLHDEPYTDFDGTRVYSPPEWISRHQYHALPATVWSLGILLYDMVCGDIPFER
DQEILEAELHFPAHVSPDCCALIRRCLAPKPSSRPSLEEILLDPWMQTPAEDVPLNPSKG
GPAPLAWSLLP
|
|
|
BDBM26701 |
---|
Biotinylated Substrate Peptide |
---|
Name: | Ryanodine receptor 1 [4317-4329] |
Synonyms: | Biotinylated Substrate Peptide | RYDR | RYR1 | RYR1_HUMAN |
Type: | Peptide |
Mol. Mass.: | 2871.44 |
Organism: | n/a |
Description: | P21817[4317-4329] |
Residue: | 24 |
Sequence: | biotin-C6linker-VRRLRRLTAREAA
|
|
|