Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetMonoglyceride Lipase (MGL)
LigandBDBM26736
Substrate/CompetitorBDBM26737
Meas. Tech.Serine Hydrolase Activity Assay
pH7.4±n/a
Temperature295.15±n/a K
IC50 5.3±n/a nM
Citation Alexander JPCravatt BF The putative endocannabinoid transport blocker LY2183240 is a potent inhibitor of FAAH and several other brain serine hydrolases. J Am Chem Soc 128:9699-704 (2006) [PubMed]  Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Monoglyceride Lipase (MGL)
Name:Monoglyceride Lipase (MGL)
Synonyms:MAG lipase | Monoacylglycerol lipase
Type:Hydrolase
Mol. Mass.:33391.67
Organism:Mus musculus (mouse)
Description:Assays were using membranes of recombinant MAG Lipase transiently transfected in COS-7 cells.
Residue:303
Sequence:
MPEASSPRRTPQNVPYQDLPHLVNADGQYLFCRYWKPSGTPKALIFVSHGAGEHCGRYDE
LAHMLKGLDMLVFAHDHVGHGQSEGERMVVSDFQVFVRDVLQHVDTIQKDYPDVPIFLLG
HSMGGAISILVAAERPTYFSGMVLISPLVLANPESASTLKVLAAKLLNFVLPNMTLGRID
SSVLSRNKSEVDLYNSDPLVCRAGLKVCFGIQLLNAVARVERAMPRLTLPFLLLQGSADR
LCDSKGAYLLMESSRSQDKTLKMYEGAYHVLHRELPEVTNSVLHEVNSWVSHRIAAAGAG
CPP
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM26736
BDBM26737
NameBDBM26736
Synonyms:CHEMBL509860 | LY2183240 | N,N-dimethyl-5-[(4-phenylphenyl)methyl]-1H-1,2,3,4-tetrazole-1-carboxamide
TypeSmall organic molecule
Emp. Form.C17H17N5O
Mol. Mass.307.3498
SMILESCN(C)C(=O)n1nnnc1Cc1ccc(cc1)-c1ccccc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: