| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Neutral cholesterol ester hydrolase 1 |
|---|
| Ligand | BDBM26736 |
|---|
| Substrate/Competitor | BDBM26737 |
|---|
| Meas. Tech. | Serine Hydrolase Activity Assay |
|---|
| pH | 7.4±n/a |
|---|
| Temperature | 295.15±n/a K |
|---|
| IC50 | 8.2±n/a nM |
|---|
| Citation |  Alexander, JP; Cravatt, BF The putative endocannabinoid transport blocker LY2183240 is a potent inhibitor of FAAH and several other brain serine hydrolases. J Am Chem Soc128:9699-704 (2006) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Solution Info, Assay Method |
|---|
| |
| Neutral cholesterol ester hydrolase 1 |
|---|
| Name: | Neutral cholesterol ester hydrolase 1 |
|---|
| Synonyms: | Aadacl1 | Arylacetamide deacetylase-like 1 | CPO-BP | Chlorpyrifos oxon-binding protein | Kiaa1363 | NCEH | NCEH1_MOUSE | Nceh1 | Neutral cholesterol ester hydrolase |
|---|
| Type: | Single-pass type II membrane protein; hydrolase |
|---|
| Mol. Mass.: | 45742.11 |
|---|
| Organism: | Mus musculus (mouse) |
|---|
| Description: | Assays were using membranes of recombinant KIAA1363 transiently transfected in COS-7 cells. |
|---|
| Residue: | 408 |
|---|
| Sequence: | MRSSCVLLAALLALAAYYVYIPLPSAVSDPWKLMLLDATFRGAQQVSNLIHSLGLNHHLI
ALNFIITSFGKQSARSSPKVKVTDTDFDGVEVRVFEGSPKPEEPLRRSVIYIHGGGWALA
SAKISYYDQLCTTMAEELNAVIVSIEYRLVPQVYFPEQIHDVIRATKYFLQPEVLDKYKV
DPGRVGISGDSAGGNLAAALGQQFTYVASLKNKLKLQALVYPVLQALDFNTPSYQQSMNT
PILPRHVMVRYWLDYFKGNYDFVEAMIVNNHTSLDVERAAALRARLDWTSLLPSSIKKNY
KPIMQTTGNARIVQEIPQLLDAAASPLIAEQEVLEALPKTYILTCEHDVLRDDGIMYAKR
LESAGVNVTLDHFEDGFHGCMIFTSWPTNFSVGIRTRNSYIKWLDQNL
|
|
|
|---|
| BDBM26736 |
|---|
| BDBM26737 |
|---|
| Name | BDBM26736 |
|---|
| Synonyms: | CHEMBL509860 | LY2183240 | N,N-dimethyl-5-[(4-phenylphenyl)methyl]-1H-1,2,3,4-tetrazole-1-carboxamide |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C17H17N5O |
|---|
| Mol. Mass. | 307.3498 |
|---|
| SMILES | CN(C)C(=O)n1nnnc1Cc1ccc(cc1)-c1ccccc1 |
|---|
| Structure | 
|
|---|
Search and Browse
