| Reaction Details |
|---|
 | Report a problem with these data |
| Target | C-C motif chemokine 3 |
|---|
| Ligand | BDBM50070114 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | cytomteric bead array (CBA) assay |
|---|
| Temperature | 310.15±n/a K |
|---|
| IC50 | >10000±n/a nM |
|---|
| Comments | extracted |
|---|
| Citation |  Gandhi, A; Dimartino, J; Chopra, R Methods for the treatment of locally advanced breast cancer US Patent US9694015 Publication Date 7/4/2017 |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| C-C motif chemokine 3 |
|---|
| Name: | C-C motif chemokine 3 |
|---|
| Synonyms: | CCL3 | CCL3_HUMAN | G0/G1 switch regulatory protein 19-1 | G0S19-1 | MIP-1-alpha | MIP1A | Macrophage inflammatory protein 1-alpha | PAT 464.1 | SCYA3 | SIS-beta | Small-inducible cytokine A3 | Tonsillar lymphocyte LD78 alpha protein |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 10083.38 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P10147 |
|---|
| Residue: | 92 |
|---|
| Sequence: | MQVSTAALAVLLCTMALCNQFSASLAADTPTACCFSYTSRQIPQNFIADYFETSSQCSKP
GVIFLTKRSRQVCADPSEEWVQKYVSDLELSA
|
|
|
|---|
| BDBM50070114 |
|---|
| n/a |
|---|
| Name | BDBM50070114 |
|---|
| Synonyms: | (+/-)-thalidomide | 2-(2,6-Dioxo-piperidin-3-yl)-isoindole-1,3-dione | 2-(2,6-dioxopiperidin-3-yl)isoindoline-1,3-dione | CHEMBL468 | K-17 | THALIDOMIDE | Thalomid | US11059801, Compound D-62 | [(R,S)-2-(2,6-dioxo-3-piperidinyl)-1H-isoindole-1,3(2H)-dione |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C13H10N2O4 |
|---|
| Mol. Mass. | 258.2295 |
|---|
| SMILES | O=C1N(C2CCC(=O)NC2=O)C(=O)c2ccccc12 |
|---|
| Structure | 
|
|---|
Search and Browse
