Reaction Details |
| Report a problem with these data |
Target | Disintegrin and metalloproteinase domain-containing protein 17 |
---|
Ligand | BDBM26809 |
---|
Substrate/Competitor | TACE substrate peptide |
---|
Meas. Tech. | Enzyme Inhibition Assay |
---|
pH | 7.5±n/a |
---|
Temperature | 298.15±n/a K |
---|
IC50 | 1.0±n/a nM |
---|
Citation | Ott, GR; Asakawa, N; Liu, RQ; Covington, MB; Qian, M; Vaddi, K; Newton, RC; Trzaskos, JM; Christ, DD; Galya, L; Scholz, T; Marshall, W; Duan, JJ Alpha,Beta-cyclic-beta-benzamido hydroxamic acids: Novel oxaspiro[4.4]nonane templates for the discovery of potent, selective, orally bioavailable inhibitors of tumor necrosis factor-alpha converting enzyme (TACE). Bioorg Med Chem Lett18:1288-92 (2008) [PubMed] Article |
---|
More Info.: | Get all data from this article, Solution Info, Assay Method |
---|
|
Disintegrin and metalloproteinase domain-containing protein 17 |
---|
Name: | Disintegrin and metalloproteinase domain-containing protein 17 |
Synonyms: | A disintegrin and metalloproteinase domain 17 | ADA17_PIG | ADAM 17 | ADAM17 | Snake venom-like protease | TACE | TNF-alpha-Converting Enzyme |
Type: | Metalloprotease |
Mol. Mass.: | 12197.99 |
Organism: | Sus scrofa (pig) |
Description: | Partially purified TACE was obtained from porcine spleen. |
Residue: | 112 |
Sequence: | MLREQFSFDIAEEASKVCLAHLFTYQDFDMGTLGLAYVGSPRANSHGGVCPKAYYSPIGK
KNIYLNSGLTSTKNYGKTILTKEADLVTTHELGHNFGAEHDPDGLAECAPNE
|
|
|
BDBM26809 |
---|
TACE substrate peptide |
---|
Name: | TACE substrate peptide |
Synonyms: | n/a |
Type: | Internally quenched peptide |
Mol. Mass.: | 4119.10 |
Organism: | n/a |
Description: | MCA, (7-methoxycoumarin-4-yl)acetyl. Dpa, N-3-(2,4-dinitrophenyl)-L-2,3-diaminopropionyl. |
Residue: | 39 |
Sequence: | MCA-Pro-Leu-Ala-Gln-Ala-Val-Dpa-Arg-Ser-Ser-Ser-Arg-NH2
|
|
|