| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Carbonic anhydrase 15 [19-324] |
|---|
| Ligand | BDBM10875 |
|---|
| Substrate/Competitor | BDBM10856 |
|---|
| Meas. Tech. | CA Inhibition Assay |
|---|
| pH | 7.5±n/a |
|---|
| Temperature | 293.15±n/a K |
|---|
| Ki | 60±n/a nM |
|---|
| Citation |  Hilvo, M; Salzano, AM; Innocenti, A; Kulomaa, MS; Scozzafava, A; Scaloni, A; Parkkila, S; Supuran, CT Cloning, expression, post-translational modifications and inhibition studies on the latest mammalian carbonic anhydrase isoform, CA XV. J Med Chem52:646-54 (2009) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Inhibition_Run data, Solution Info, Assay Method |
|---|
| |
| Carbonic anhydrase 15 [19-324] |
|---|
| Name: | Carbonic anhydrase 15 [19-324] |
|---|
| Synonyms: | CA-XV | CAH15_MOUSE | Ca15 | Car15 | Carbonate dehydratase XV | Carbonic Anhydrase XV |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 33409.51 |
|---|
| Organism: | Mus musculus (mouse) |
|---|
| Description: | Mouse cloned isozyme. |
|---|
| Residue: | 306 |
|---|
| Sequence: | VDSSGTWCYDSQDPKCGPAHWKELAPACGGPTQSPINIDLRLVQRDYTLKPFIFQGYDSA
PQDPWVLENDGHTVLLRVNSCQQNCPAIRGAGLPSPEYRLLQLHFHWGSPGHQGSEHSLD
EKHGSMEMHMVHMNTKYQSMEDARSQPDGFAILAVLLVEEDRDNTNFSAIVSGLKNLSSP
GVAVNLTSTFALASLLPSALRLLRYYRYSGSLTTPGCEPAVLWTVFENTVPIGHAQVVQF
QAVLQTGPPGLHPRPLTSNFRPQQPLGGRRISASPEASVRSSVSTLPCLHLALVGLGVGL
RLWQGP
|
|
|
|---|
| BDBM10875 |
|---|
| BDBM10856 |
|---|
| Name | BDBM10875 |
|---|
| Synonyms: | 5-(2-chlorophenyl)-1,3,4-thiadiazole-2-sulfonamide | CHEMBL360356 | Chlorzolamide, CHL | JMC522226 Compound 19 | JMC523116 Compound 19 | aromatic/heteroaromatic sulfonamide 20 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C8H6ClN3O2S2 |
|---|
| Mol. Mass. | 275.735 |
|---|
| SMILES | NS(=O)(=O)c1nnc(s1)-c1ccccc1Cl |
|---|
| Structure | 
|
|---|
Search and Browse
