Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetAurora kinase B
LigandBDBM27087
Substrate/CompetitorBiotinylated Cross-tide Substrate
Meas. Tech.Aurora Kinase Assay
pH8.5±n/a
Temperature295.15±n/a K
Comments58% inhibition @ 3 nM.
Citation Howard SBerdini VBoulstridge JACarr MGCross DMCurry JDevine LAEarly TRFazal LGill ALHeathcote MMaman SMatthews JEMcMenamin RLNavarro EFO'Brien MAO'Reilly MRees DCReule MTisi DWilliams GVinković MWyatt PG Fragment-based discovery of the pyrazol-4-yl urea (AT9283), a multitargeted kinase inhibitor with potent aurora kinase activity. J Med Chem 52:379-88 (2009) [PubMed]  Article
More Info.:Get all data from this article,  Inhibition_Run data,   Solution Info,  Assay Method
 
Aurora kinase B
Name:Aurora kinase B
Synonyms:AIM-1 | Aurora B kinase (aurB) | Aurora B-INCENP | Aurora kinase 2 | Aurora kinase B (AURKB) | Aurora-related kinase 2 | STK-1 | Serine/threonine-protein kinase aurora B
Type:Protein
Mol. Mass.:39327.72
Organism:Homo sapiens (Human)
Description:Q96GD4
Residue:344
Sequence:
MAQKENSYPWPYGRQTAPSGLSTLPQRVLRKEPVTPSALVLMSRSNVQPTAAPGQKVMEN
SSGTPDILTRHFTIDDFEIGRPLGKGKFGNVYLAREKKSHFIVALKVLFKSQIEKEGVEH
QLRREIEIQAHLHHPNILRLYNYFYDRRRIYLILEYAPRGELYKELQKSCTFDEQRTATI
MEELADALMYCHGKKVIHRDIKPENLLLGLKGELKIADFGWSVHAPSLRRKTMCGTLDYL
PPEMIEGRMHNEKVDLWCIGVLCYELLVGNPPFESASHNETYRRIVKVDLKFPASVPMGA
QDLISKLLRHNPSERLPLAQVSAHPWVRANSRRVLPPSALQSVA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM27087
Biotinylated Cross-tide Substrate
Name:Biotinylated Cross-tide Substrate
Synonyms:n/a
Type:Peptide
Mol. Mass.:2578.93
Organism:n/a
Description:n/a
Residue:24
Sequence:
biotin-CGPKGPGRRGRRRTSSFAEG