Ki Summary BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHistone deacetylase 8
LigandBDBM19149
Substrate/CompetitorFluor de Lys-HDAC8 Fluorogenic Deacetylase Substrate
Meas. Tech.HDAC Activity Assay
Temperature298.15±n/a K
IC50 1860±n/a nM
Commentsextracted
Citation Oyelere AKChen PCGuerrant WMwakwari SCHood RZhang YFan Y Non-peptide macrocyclic histone deacetylase inhibitors. J Med Chem 52:456-68 (2009) [PubMed]  Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Histone deacetylase 8
Name:Histone deacetylase 8
Synonyms:HD8 | Histone deacetylase 8 (HDAC-8) | Human HDAC8
Type:Enzyme
Mol. Mass.:41749.60
Organism:Homo sapiens (Human)
Description:Q9BY41
Residue:377
Sequence:
MEEPEEPADSGQSLVPVYIYSPEYVSMCDSLAKIPKRASMVHSLIEAYALHKQMRIVKPK
VASMEEMATFHTDAYLQHLQKVSQEGDDDHPDSIEYGLGYDCPATEGIFDYAAAIGGATI
TAAQCLIDGMCKVAINWSGGWHHAKKDEASGFCYLNDAVLGILRLRRKFERILYVDLDLH
HGDGVEDAFSFTSKVMTVSLHKFSPGFFPGTGDVSDVGLGKGRYYSVNVPIQDGIQDEKY
YQICESVLKEVYQAFNPKAVVLQLGADTIAGDPMCSFNMTPVGIGKCLKYILQWQLATLI
LGGGGYNLANTARCWTYLTGVILGKTLSSEIPDHEFFTAYGPDYVLEITPSCRPDRNEPH
RIQQILNYIKGNLKHVV
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM19149
Fluor de Lys-HDAC8 Fluorogenic Deacetylase Substrate
Name:Fluor de Lys-HDAC8 Fluorogenic Deacetylase Substrate
Synonyms:n/a
Type:fluorogenic, diacetylated peptide
Mol. Mass.:1716.47
Organism:n/a
Description:Residues 379-382 of p53.
Residue:16
Sequence:
Arg-His-Lys(Ac)-Lys(Ac)