Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHistamine H1 receptor
LigandBDBM27213
Substrate/CompetitorBDBM22567
Meas. Tech.Radioligand Binding Assay
pH7.4±n/a
Temperature298.15±n/a K
Ki>10000±n/a nM
Citation Zhao CSun MBennani YLGopalakrishnan SMWitte DGMiller TRKrueger KMBrowman KEThiffault CWetter JMarsh KCHancock AAEsbenshade TACowart MD The alkaloid conessine and analogues as potent histamine H3 receptor antagonists. J Med Chem 51:5423-30 (2008) [PubMed]  Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Histamine H1 receptor
Name:Histamine H1 receptor
Synonyms:H1R | HH1R | HISTAMINE H1 | HRH1
Type:G Protein-Coupled Receptor (GPCR)
Mol. Mass.:55808.72
Organism:Homo sapiens (Human)
Description:Cell pellets from SK-N-MC cells transfected with human H1 receptor were used in binding assay.
Residue:487
Sequence:
MSLPNSSCLLEDKMCEGNKTTMASPQLMPLVVVLSTICLVTVGLNLLVLYAVRSERKLHT
VGNLYIVSLSVADLIVGAVVMPMNILYLLMSKWSLGRPLCLFWLSMDYVASTASIFSVFI
LCIDRYRSVQQPLRYLKYRTKTRASATILGAWFLSFLWVIPILGWNHFMQQTSVRREDKC
ETDFYDVTWFKVMTAIINFYLPTLLMLWFYAKIYKAVRQHCQHRELINRSLPSFSEIKLR
PENPKGDAKKPGKESPWEVLKRKPKDAGGGSVLKSPSQTPKEMKSPVVFSQEDDREVDKL
YCFPLDIVHMQAAAEGSSRDYVAVNRSHGQLKTDEQGLNTHGASEISEDQMLGDSQSFSR
TDSDTTTETAPGKGKLRSGSNTGLDYIKFTWKRLRSHSRQYVSGLHMNRERKAAKQLGFI
MAAFILCWIPYFIFFMVIAFCKNCCNEHLHMFTIWLGYINSTLNPLIYPLCNENFKKTFK
RILHIRS
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM27213
BDBM22567
NameBDBM27213
Synonyms:4-[3-(4-cyclopropanecarbonylphenoxy)propyl]-1H-imidazole | CHEMBL14638 | CHEMBL1795025 | Ciproxifan
TypeSmall organic molecule
Emp. Form.C16H18N2O2
Mol. Mass.270.3263
SMILESO=C(C1CC1)c1ccc(OCCCc2cnc[nH]2)cc1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: