Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetCdc7 Kinase
LigandBDBM27416
Substrate/CompetitorMCM2
Meas. Tech.In Vitro Kinase Assay
IC50>5000±n/a nM
Citation Vanotti EAmici RBargiotti ABerthelsen JBosotti RCiavolella ACirla ACristiani CD'Alessio RForte BIsacchi AMartina KMenichincheri MMolinari AMontagnoli AOrsini PPillan ARoletto FScolaro ATibolla MValsasina BVarasi MVolpi DSantocanale C Cdc7 kinase inhibitors: pyrrolopyridinones as potential antitumor agents. 1. Synthesis and structure-activity relationships. J Med Chem 51:487-501 (2008) [PubMed]  Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Cdc7 Kinase
Name:Cdc7 Kinase
Synonyms:Cdc7/DBF4
Type:Protein Complex
Mol. Mass.:n/a
Description:n/a
Components:This complex has 2 components.
Component 1
Name:Cdc7 Kinase
Synonyms:Cell division cycle 7-related protein kinase
Type:Serine/threonine-protein kinase
Mol. Mass.:57470.88
Organism:Homo sapiens (Human)
Description:n/a
Residue:517
Sequence:
FKIEDKIGEGTFSSVYLATAQLQVGPEEKIALKHLIPTSHPIRIAAELQCLTVAGGQDNV
MGVKYCFRKNDHVVIAMPYLEHESFLDILNSLSFQEVREYMLNLFKALKRIHQFGIVHRD
VKPSNFLYNRRLKKYALVDFGLAQGTHDTKIELLKFVQSEAQQERCSQNKSHIITGNKIP
LSGPVPKELDQQSTTKASVKRPYTNAQIQIKQGKDGKEGSVGLSVQRSVFGERNFNIHSS
ISHESPAVKLMKQSKTVDVLSRKLATKKKAISTKVMNSAVMRKTASSCPASLTCDCYATD
KVCSICLSRRQQVAPRAGTPGFRAPEVLTKCPNQTTAIDMWSAGVIFLSLLSGRYPFYKA
SDDLTALAQIMTIRGSRETIQAAKTFGKSILCSKEVPAQDLRKLCERLRGMDSSTPKLTS
DIQGHASHQPAISEKTDHKASCLVQTPPGQYSGNSFKKGDSNSCEHCFDEYNTNLEGWNE
VPDEAYDLLDKLLDLNPASRITAEEALLHPFFKDMSL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
Component 2
Name:DBF4
Synonyms:Activator of S phase kinase | Chiffon homolog A | DBF4-type zinc finger-containing protein 1 | DBF4A | Protein DBF4 homolog A
Type:Regulatory subunit
Mol. Mass.:76869.65
Organism:Homo sapiens (Human)
Description:n/a
Residue:674
Sequence:
MNSGAMRIHSKGHFQGGIQVKNEKNRPSLKSLKTDNRPEKSKCKPLWGKVFYLDLPSVTI
SEKLQKDIKDLGGRVEEFLSKDISYLISNKKEAKFAQTLGRISPVPSPESAYTAETTSPH
PSHDGSSFKSPDTVCLSRGKLLVEKAIKDHDFIPSNSILSNALSWGVKILHIDDIRYYIE
QKKKELYLLKKSSTSVRDGGKRVGSGAQKTRTGRLKKPFVKVEDMSQLYRPFYLQLTNMP
FINYSIQKPCSPFDVDKPSSMQKQTQVKLRIQTDGDKYGGTSIQLQLKEKKKKGYCECCL
QKYEDLETHLLSEQHRNFAQSNQYQVVDDIVSKLVFDFVEYEKDTPKKKRIKYSVGSLSP
VSASVLKKTEQKEKVELQHISQKDCQEDDTTVKEQNFLYKETQETEKKLLFISEPIPHPS
NELRGLNEKMSNKCSMLSTAEDDIRQNFTQLPLHKNKQECILDISEHTLSENDLEELRVD
HYKCNIQASVHVSDFSTDNSGSQPKQKSDTVLFPAKDLKEKDLHSIFTHDSGLITINSSQ
EHLTVQAKAPFHTPPEEPNECDFKNMDSLPSGKIHRKVKIILGRNRKENLEPNAEFDKRT
EFITQEENRICSSPVQSLLDLFQTSEEKSEFLGFTSYTEKSGICNVLDIWEEENSDNLLT
AFFSSPSTSTFTGF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM27416
MCM2
Name:MCM2
Synonyms:DNA replication licensing factor MCM2 | Minichromosome maintenance protein 2 homolog | Nuclear protein BM28
Type:Other Protein Type
Mol. Mass.:32619.37
Organism:Homo sapiens (Human)
Description:n/a
Residue:285
Sequence:
MASSPAQRRRGNDPLTSSPGRSSRRTDALTSSPGRDLPPFEDESEGLLGTEGPLEEEEDG
EELIGDGMERDYRAIPELDAYEAEGLALDDEDVEELTASQREAAERAMRQRDREAGRGLG
RMRRGLLYDSDEEDEERPARKRRQVERATEDGEEDEEMIESIENLEDLKGHSVREWVSMA
GPRLEIHHRFKNFLRTHVDSHGHNVFKERISDMCKENRESLVVNYEDLAAREHVLAYFLP
EAPAELLQIFDEAALEVVLAMYPKYDRITNHIHVRISHLPLVEEL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff: