Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHIV-1 Reverse Transcriptase Mutant (103N/181C)
LigandBDBM27595
Substrate/Competitorpoly rC/biotin-dG15
Meas. Tech.Reverse Transcriptase Assay
IC50 178±n/a nM
Citation Gagnon ALandry SCoulombe RJakalian AGuse IThavonekham BBonneau PRYoakim CSimoneau B Investigation on the role of the tetrazole in the binding of thiotetrazolylacetanilides with HIV-1 wild type and K103N/Y181C double mutant reverse transcriptases. Bioorg Med Chem Lett 19:1199-205 (2009) [PubMed]  Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
HIV-1 Reverse Transcriptase Mutant (103N/181C)
Name:HIV-1 Reverse Transcriptase Mutant (103N/181C)
Synonyms:n/a
Type:Protein Complex
Mol. Mass.:n/a
Description:n/a
Components:This complex has 2 components.
Component 1
Name:HIV-1 Reverse Transcriptase Mutant (103N/181C) Chain A
Synonyms:n/a
Type:Enzyme Subunit
Mol. Mass.:64411.30
Organism:Human immunodeficiency virus type 1
Description:n/a
Residue:560
Sequence:
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
CQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGA
HTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTP
PLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQ
AIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHK
GIGGNEQVDKLVSAGIRKVL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
Component 2
Name:HIV-1 Reverse Transcriptase Mutant (103N/181C) Chain B
Synonyms:n/a
Type:Enzyme Subunit
Mol. Mass.:51262.02
Organism:Human immunodeficiency virus type 1
Description:n/a
Residue:440
Sequence:
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
CQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGA
HTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTP
PLVKLWYQLEKEPIVGAETF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM27595
poly rC/biotin-dG15
Name:poly rC/biotin-dG15
Synonyms:n/a
Type:RNA/DNA duplex
Mol. Mass.:358.43
Organism:n/a
Description:The incorporation of [3H]dGTP onto a (poly)rC:(biotin)dG template:primer.
Residue:3
Sequence:
n/a