Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetHIV-1 Reverse Transcriptase Mutant (103N/181C)
LigandBDBM27611
Substrate/CompetitorRNA:Biotin-DNA template:primer
Meas. Tech.HIV-1 Reverse Transcriptase Assay
pH8±n/a
Temperature303.15±n/a K
IC50 12±n/a nM
EC50 97±n/a nM
Citation Sweeney ZKHarris SFArora SFJavanbakht HLi YFretland JDavidson JPBilledeau JRGleason SKHirschfeld DKennedy-Smith JJMirzadegan TRoetz RSmith MSperry SSuh JMWu JTsing SVillaseñor AGPaul ASu GHeilek GHang JQZhou ASJernelius JAZhang FJKlumpp K Design of annulated pyrazoles as inhibitors of HIV-1 reverse transcriptase. J Med Chem 51:7449-58 (2008) [PubMed]  Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
HIV-1 Reverse Transcriptase Mutant (103N/181C)
Name:HIV-1 Reverse Transcriptase Mutant (103N/181C)
Synonyms:n/a
Type:Protein Complex
Mol. Mass.:n/a
Description:n/a
Components:This complex has 2 components.
Component 1
Name:HIV-1 Reverse Transcriptase Mutant (103N/181C) Chain A
Synonyms:n/a
Type:Enzyme Subunit
Mol. Mass.:64411.30
Organism:Human immunodeficiency virus type 1
Description:n/a
Residue:560
Sequence:
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
CQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGA
HTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTP
PLVKLWYQLEKEPIVGAETFYVDGAANRETKLGKAGYVTNRGRQKVVTLTDTTNQKTELQ
AIYLALQDSGLEVNIVTDSQYALGIIQAQPDQSESELVNQIIEQLIKKEKVYLAWVPAHK
GIGGNEQVDKLVSAGIRKVL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
Component 2
Name:HIV-1 Reverse Transcriptase Mutant (103N/181C) Chain B
Synonyms:n/a
Type:Enzyme Subunit
Mol. Mass.:51262.02
Organism:Human immunodeficiency virus type 1
Description:n/a
Residue:440
Sequence:
PISPIETVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKNKSVTVLDVGDAYFSVPL
DEDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
CQYMDDLYVGSDLEIGQHRTKIEELRQHLLRWGLTTPDKKHQKEPPFLWMGYELHPDKWT
VQPIVLPEKDSWTVNDIQKLVGKLNWASQIYPGIKVRQLCKLLRGTKALTEVIPLTEEAE
LELAENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGA
HTNDVKQLTEAVQKITTESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNTP
PLVKLWYQLEKEPIVGAETF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM27611
RNA:Biotin-DNA template:primer
Name:RNA:Biotin-DNA template:primer
Synonyms:n/a
Type:RNA/DNA duplex
Mol. Mass.:2957.49
Organism:n/a
Description:The incorporation of [3H]dATP onto a RNA:(biotin)DNA template:primer.
Residue:38
Sequence:
5-GGG UCU CUC UGG UUA GAC CAC UCU AGC AGU GGC GCC CGA ACA GG
G AC-3