Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
Targetc-Jun N-terminal kinase, JNK
LigandBDBM27786
Substrate/CompetitorBiotin-GST-c-JUN
Meas. Tech.IGF-1R Inhibition Assay
IC50 631±n/a nM
Citation Chamberlain SDRedman AMWilson JWDeanda FShotwell JBGerding RLei HYang BStevens KLHassell AMShewchuk LMLeesnitzer MASmith JLSabbatini PAtkins CGroy ARowand JLKumar RMook RAMoorthy GPatnaik S Optimization of 4,6-bis-anilino-1H-pyrrolo[2,3-d]pyrimidine IGF-1R tyrosine kinase inhibitors towards JNK selectivity. Bioorg Med Chem Lett 19:360-4 (2009) [PubMed]  Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
c-Jun N-terminal kinase, JNK
Name:c-Jun N-terminal kinase, JNK
Synonyms:JNK-46 | JNK1 | JNK1-alpha-1 | Mitogen-Activated Protein Kinase 8 (JNK1) | Stress-activated protein kinase JNK1 | c-Jun N-terminal kinase 1 | c-Jun N-terminal kinase 1 (JNK1) | c-Jun N-terminal kinase 1(JNK1) | c-Jun N-terminal kinase 2 (JNK2)
Type:Enzyme
Mol. Mass.:48297.57
Organism:Homo sapiens (Human)
Description:JNK-1 was purchased from Upstate Cell Signaling Solutions (formerly Upstate Biotechnology).
Residue:427
Sequence:
MSRSKRDNNFYSVEIGDSTFTVLKRYQNLKPIGSGAQGIVCAAYDAILERNVAIKKLSRP
FQNQTHAKRAYRELVLMKCVNHKNIIGLLNVFTPQKSLEEFQDVYIVMELMDANLCQVIQ
MELDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAGTSF
MMTPYVVTRYYRAPEVILGMGYKENVDLWSVGCIMGEMVCHKILFPGRDYIDQWNKVIEQ
LGTPCPEFMKKLQPTVRTYVENRPKYAGYSFEKLFPDVLFPADSEHNKLKASQARDLLSK
MLVIDASKRISVDEALQHPYINVWYDPSEAEAPPPKIPDKQLDEREHTIEEWKELIYKEV
MDLEERTKNGVIRGQPSPLGAAVINGSQHPSSSSSVNDVSSMSTDPTLASDTDSSLEAAA
GPLGCCR
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM27786
Biotin-GST-c-JUN
Name:Biotin-GST-c-JUN
Synonyms:n/a
Type:Other Protein Type
Mol. Mass.:8641.27
Organism:Rattus norvegicus (rat)
Description:GST-c-Jun (1-79) fusion protein was biotinylated.
Residue:79
Sequence:
MTAKMETTFYDDALNASFLQSESGAYGYSNPKILKQSMTLNLADPVGNLKPHLRAKNSDL
LTSPDVGLLKLASPELERL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff: