Reaction Details |
| Report a problem with these data |
Target | Complex of Baculoviral IAP repeat-containing protein 7 [63-159,S150G] and E3 ubiquitin-protein ligase XIAP [336-348] |
---|
Ligand | BDBM27933 |
---|
Substrate/Competitor | BDBM17342 |
---|
Meas. Tech. | Fluorescence Polarization Affinity Measurements |
---|
pH | 7.2±n/a |
---|
Temperature | 295.15±n/a K |
---|
Ki | 1500±n/a nM |
---|
Citation | Cohen, F; Alicke, B; Elliott, LO; Flygare, JA; Goncharov, T; Keteltas, SF; Franklin, MC; Frankovitz, S; Stephan, JP; Tsui, V; Vucic, D; Wong, H; Fairbrother, WJ Orally bioavailable antagonists of inhibitor of apoptosis proteins based on an azabicyclooctane scaffold. J Med Chem52:1723-30 (2009) [PubMed] Article |
---|
More Info.: | Get all data from this article, Solution Info, Assay Method |
---|
|
Complex of Baculoviral IAP repeat-containing protein 7 [63-159,S150G] and E3 ubiquitin-protein ligase XIAP [336-348] |
---|
Name: | Complex of Baculoviral IAP repeat-containing protein 7 [63-159,S150G] and E3 ubiquitin-protein ligase XIAP [336-348] |
Synonyms: | Chimeric protein of melanoma inhibitor of apoptosis protein and XIAP-BIR3 | ML-IAP-BIR | MLXBIR3SG |
Type: | Chimeric Protein |
Mol. Mass.: | 14953.37 |
Organism: | Homo sapiens (Human) |
Description: | Q96CA5[63-159,S150G],P98170[336-348] |
Residue: | 133 |
Sequence: | MGSSHHHHHHSSGEVPRGSHMLETEEEEEEGAGATLSRGPAFPGMGSEELRLASFYDWPL
TAEVPPELLAAAGFFHTGHQDKVRCFFCYGGLQSWKRGDDPWTEHAKWFPGCQFLLRSKG
QEYINNIHLTHSL
|
|
|
BDBM27933 |
---|
BDBM17342 |
---|
Name | BDBM27933 |
Synonyms: | Azabicyclooctane scaffold, 14p | N-[(3aR,6S,6aS)-1-[(2S)-3,3-dimethyl-2-[(2S)-2-(methylamino)propanamido]butanoyl]-octahydrocyclopenta[b]pyrrol-6-yl]-2,3-dihydro-1-benzofuran-3-carboxamide |
Type | Small organic molecule |
Emp. Form. | C26H38N4O4 |
Mol. Mass. | 470.6043 |
SMILES | [H][C@]12CC[C@H](NC(=O)C3COc4ccccc34)[C@@]1([H])N(CC2)C(=O)[C@@H](NC(=O)[C@H](C)NC)C(C)(C)C |r| |
Structure |
|