| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Orotidine 5'-phosphate decarboxylase |
|---|
| Ligand | BDBM21335 |
|---|
| Substrate/Competitor | BDBM21336 |
|---|
| Meas. Tech. | Enzyme Inhibition Assay |
|---|
| pH | 7.5±n/a |
|---|
| Temperature | 328.15±n/a K |
|---|
| Ki | 29000±2000 nM |
|---|
| Citation |  Bello, AM; Konforte, D; Poduch, E; Furlonger, C; Wei, L; Liu, Y; Lewis, M; Pai, EF; Paige, CJ; Kotra, LP Structure-activity relationships of orotidine-5'-monophosphate decarboxylase inhibitors as anticancer agents. J Med Chem52:1648-58 (2009) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Solution Info, Assay Method |
|---|
| |
| Orotidine 5'-phosphate decarboxylase |
|---|
| Name: | Orotidine 5'-phosphate decarboxylase |
|---|
| Synonyms: | OMP decarboxylase | OMPDCase | Orotidine 5-phosphate decarboxylase | Orotidine Monophosphate Decarboxylase (ODCase) | PYRF_METTH | pyrF |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 24909.45 |
|---|
| Organism: | Methanobacterium thermoautotrophicum |
|---|
| Description: | n/a |
|---|
| Residue: | 228 |
|---|
| Sequence: | MRSRRVDVMDVMNRLILAMDLMNRDDALRVTGEVREYIDTVKIGYPLVLSEGMDIIAEFR
KRFGCRIIADFKVADIPETNEKICRATFKAGADAIIVHGFRGADSVRACLNVAEEMGREV
FLLTEMSHPGAEMFIQGAADEIARMGVDLGVKNYVGPSTRPERLSRLREIIGQDSFLISP
GVGAQGGDPGETLRFADAIIVGRSIYLADNPAAAAAGIIESIKDLLNP
|
|
|
|---|
| BDBM21335 |
|---|
| BDBM21336 |
|---|
| Name | BDBM21335 |
|---|
| Synonyms: | 6-cyanouridine 5-monophosphate | C6-Uridine Derivative, 6 | JMC521648 Compound 34 | {[(2R,3S,4R,5R)-5-(6-cyano-2,4-dioxo-1,2,3,4-tetrahydropyrimidin-1-yl)-3,4-dihydroxyoxolan-2-yl]methoxy}phosphonic acid |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C10H12N3O9P |
|---|
| Mol. Mass. | 349.1907 |
|---|
| SMILES | O[C@@H]1[C@@H](COP(O)(O)=O)O[C@H]([C@@H]1O)n1c(cc(=O)[nH]c1=O)C#N |r| |
|---|
| Structure | 
|
|---|
Search and Browse
