Reaction Details |
| Report a problem with these data |
Target | Orotidine 5'-phosphate decarboxylase |
---|
Ligand | BDBM27944 |
---|
Substrate/Competitor | BDBM21336 |
---|
Meas. Tech. | Enzyme Inhibition Assay |
---|
pH | 7.5±n/a |
---|
Temperature | 328.15±n/a K |
---|
Ki | 360±30 nM |
---|
Citation | Bello, AM; Konforte, D; Poduch, E; Furlonger, C; Wei, L; Liu, Y; Lewis, M; Pai, EF; Paige, CJ; Kotra, LP Structure-activity relationships of orotidine-5'-monophosphate decarboxylase inhibitors as anticancer agents. J Med Chem52:1648-58 (2009) [PubMed] Article |
---|
More Info.: | Get all data from this article, Solution Info, Assay Method |
---|
|
Orotidine 5'-phosphate decarboxylase |
---|
Name: | Orotidine 5'-phosphate decarboxylase |
Synonyms: | OMP decarboxylase | OMPDCase | Orotidine 5-phosphate decarboxylase | Orotidine Monophosphate Decarboxylase (ODCase) | PYRF_METTH | pyrF |
Type: | Enzyme |
Mol. Mass.: | 24909.45 |
Organism: | Methanobacterium thermoautotrophicum |
Description: | n/a |
Residue: | 228 |
Sequence: | MRSRRVDVMDVMNRLILAMDLMNRDDALRVTGEVREYIDTVKIGYPLVLSEGMDIIAEFR
KRFGCRIIADFKVADIPETNEKICRATFKAGADAIIVHGFRGADSVRACLNVAEEMGREV
FLLTEMSHPGAEMFIQGAADEIARMGVDLGVKNYVGPSTRPERLSRLREIIGQDSFLISP
GVGAQGGDPGETLRFADAIIVGRSIYLADNPAAAAAGIIESIKDLLNP
|
|
|
BDBM27944 |
---|
BDBM21336 |
---|
Name | BDBM27944 |
Synonyms: | uridine derivative, 41 | {[(2R,3S,4R,5R)-5-(6-azido-5-fluoro-2,4-dioxo-1,2,3,4-tetrahydropyrimidin-1-yl)-3,4-dihydroxyoxolan-2-yl]methoxy}phosphonic acid |
Type | n/a |
Emp. Form. | C9H11FN5O9P |
Mol. Mass. | 383.1839 |
SMILES | O[C@H]1[C@@H](O)[C@@H](O[C@@H]1COP(O)(O)=O)n1c(N=[N+]=[N-])c(F)c(=O)[nH]c1=O |r| |
Structure |
|