Reaction Details |
| Report a problem with these data |
Target | Serine/threonine-protein kinase pim-2 |
---|
Ligand | BDBM28411 |
---|
Substrate/Competitor | PIM peptide substrate |
---|
Meas. Tech. | Pim Kinase Dose-Response Assay |
---|
pH | 7.5±n/a |
---|
Temperature | 295.15±n/a K |
---|
IC50 | 27±1 nM |
---|
Citation | Qian, K; Wang, L; Cywin, CL; Farmer, BT; Hickey, E; Homon, C; Jakes, S; Kashem, MA; Lee, G; Leonard, S; Li, J; Magboo, R; Mao, W; Pack, E; Peng, C; Prokopowicz, A; Welzel, M; Wolak, J; Morwick, T Hit to lead account of the discovery of a new class of inhibitors of Pim kinases and crystallographic studies revealing an unusual kinase binding mode. J Med Chem52:1814-27 (2009) [PubMed] Article |
---|
More Info.: | Get all data from this article, Inhibition_Run data, Solution Info, Assay Method |
---|
|
Serine/threonine-protein kinase pim-2 |
---|
Name: | Serine/threonine-protein kinase pim-2 |
Synonyms: | PIM2 | PIM2_HUMAN | Pim-2h | Serine/threonine-protein kinase (PIM2) | Serine/threonine-protein kinase PIM | Serine/threonine-protein kinase pim-2 (PIM2) |
Type: | Serine/threonine-protein kinase |
Mol. Mass.: | 34185.93 |
Organism: | Homo sapiens (Human) |
Description: | Q9P1W9 |
Residue: | 311 |
Sequence: | MLTKPLQGPPAPPGTPTPPPGGKDREAFEAEYRLGPLLGKGGFGTVFAGHRLTDRLQVAI
KVIPRNRVLGWSPLSDSVTCPLEVALLWKVGAGGGHPGVIRLLDWFETQEGFMLVLERPL
PAQDLFDYITEKGPLGEGPSRCFFGQVVAAIQHCHSRGVVHRDIKDENILIDLRRGCAKL
IDFGSGALLHDEPYTDFDGTRVYSPPEWISRHQYHALPATVWSLGILLYDMVCGDIPFER
DQEILEAELHFPAHVSPDCCALIRRCLAPKPSSRPSLEEILLDPWMQTPAEDVPLNPSKG
GPAPLAWSLLP
|
|
|
BDBM28411 |
---|
PIM peptide substrate |
---|
Name: | PIM peptide substrate |
Synonyms: | n/a |
Type: | Biotinylated peptide |
Mol. Mass.: | 1402.69 |
Organism: | n/a |
Description: | n/a |
Residue: | 12 |
Sequence: | |