new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetReceptor-interacting serine/threonine-protein kinase 3
LigandBDBM392925
Substrate/Competitorn/a
Meas. Tech.RIPK3 HTRF Kinase Assay
IC50<30±n/a nM
Citation Hart ACPitts WJMastalerz HGuo JBrown GD Substituted dihydro-1H-pyrrolo[3,2-c]pyridin-4(5H)-ones as RIPK3 inhibitors US Patent  US10301306 Publication Date 5/28/2019  Article
More Info.:Get all data from this article,  Assay Method
 
Receptor-interacting serine/threonine-protein kinase 3
Name:Receptor-interacting serine/threonine-protein kinase 3
Synonyms:RIP-3 | RIP-like protein kinase 3 | RIP3 | RIPK3 | Receptor-interacting protein 3
Type:PROTEIN
Mol. Mass.:56886.12
Organism:Homo sapiens (Human)
Description:ChEMBL_881455
Residue:518
Sequence:
MSCVKLWPSGAPAPLVSIEELENQELVGKGGFGTVFRAQHRKWGYDVAVKIVNSKAISRE
VKAMASLDNEFVLRLEGVIEKVNWDQDPKPALVTKFMENGSLSGLLQSQCPRPWPLLCRL
LKEVVLGMFYLHDQNPVLLHRDLKPSNVLLDPELHVKLADFGLSTFQGGSQSGTGSGEPG
GTLGYLAPELFVNVNRKASTASDVYSFGILMWAVLAGREVELPTEPSLVYEAVCNRQNRP
SLAELPQAGPETPGLEGLKELMQLCWSSEPKDRPSFQECLPKTDEVFQMVENNMNAAVST
VKDFLSQLRSSNRRFSIPESGQGGTEMDGFRRTIENQHSRNDVMVSEWLNKLNLEEPPSS
VPKKCPSLTKRSRAQEEQVPQAWTAGTSSDSMAQPPQTPETSTFRNQMPSPTSTGTPSPG
PRGNQGAERQGMNWSCRTPEPNPVTGRPLVNIYNCSGVQVGDNNYLTMQQTTALPTWGLA
PSGKGRGLQHPPPVGSQEGPKDPEAWSRPQGWYNHSGK
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM392925
n/a
NameBDBM392925
Synonyms:US10301306, Example 123
TypeSmall organic molecule
Emp. Form.C27H18F4N4O
Mol. Mass.490.4516
SMILESFc1ccc(Cn2c3CCNC(=O)c3c(c2-c2ccncc2)-c2cccc(c2)C(F)(F)F)c(c1)C#N
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: