Reaction Details |
| Report a problem with these data |
Target | Peroxisome proliferator-activated receptor delta |
---|
Ligand | BDBM28661 |
---|
Substrate/Competitor | BDBM10852 |
---|
Meas. Tech. | Cell-Based Transcription Assay |
---|
EC50 | 1±n/a nM |
---|
Citation | Sierra, ML; Beneton, V; Boullay, AB; Boyer, T; Brewster, AG; Donche, F; Forest, MC; Fouchet, MH; Gellibert, FJ; Grillot, DA; Lambert, MH; Laroze, A; Le Grumelec, C; Linget, JM; Montana, VG; Nguyen, VL; Nicodème, E; Patel, V; Penfornis, A; Pineau, O; Pohin, D; Potvain, F; Poulain, G; Ruault, CB; Saunders, M; Toum, J; Xu, HE; Xu, RX; Pianetti, PM Substituted 2-[(4-aminomethyl)phenoxy]-2-methylpropionic acid PPARalpha agonists. 1. Discovery of a novel series of potent HDLc raising agents. J Med Chem50:685-95 (2007) [PubMed] Article |
---|
More Info.: | Get all data from this article, Solution Info, Assay Method |
---|
|
Peroxisome proliferator-activated receptor delta |
---|
Name: | Peroxisome proliferator-activated receptor delta |
Synonyms: | NR1C2 | NUC1 | NUCI | Nuclear hormone receptor 1 | Nuclear receptor subfamily 1 group C member 2 | PPAR delta | PPAR-beta | PPARB | PPARD | PPARD_HUMAN | Peroxisome proliferator-activated receptor | Peroxisome proliferator-activated receptor beta | Peroxisome proliferator-activated receptor delta |
Type: | Enzyme |
Mol. Mass.: | 49910.45 |
Organism: | Homo sapiens (Human) |
Description: | Q03181 |
Residue: | 441 |
Sequence: | MEQPQEEAPEVREEEEKEEVAEAEGAPELNGGPQHALPSSSYTDLSRSSSPPSLLDQLQM
GCDGASCGSLNMECRVCGDKASGFHYGVHACEGCKGFFRRTIRMKLEYEKCERSCKIQKK
NRNKCQYCRFQKCLALGMSHNAIRFGRMPEAEKRKLVAGLTANEGSQYNPQVADLKAFSK
HIYNAYLKNFNMTKKKARSILTGKASHTAPFVIHDIETLWQAEKGLVWKQLVNGLPPYKE
ISVHVFYRCQCTTVETVRELTEFAKSIPSFSSLFLNDQVTLLKYGVHEAIFAMLASIVNK
DGLLVANGSGFVTREFLRSLRKPFSDIIEPKFEFAVKFNALELDDSDLALFIAAIILCGD
RPGLMNVPRVEAIQDTILRALEFHLQANHPDAQYLFPKLLQKMADLRQLVTEHAQMMQRI
KKTETETSLHPLLQEIYKDMY
|
|
|
BDBM28661 |
---|
BDBM10852 |
---|
Name | BDBM28661 |
Synonyms: | 2-{2-methyl-4-[({4-methyl-2-[4-(trifluoromethyl)phenyl]-1,3-thiazol-5-yl}methyl)sulfanyl]phenoxy}acetic acid | CHEMBL38943 | GW 501516 | GW-501516 | GW1516 | GW501516 |
Type | Small organic molecule |
Emp. Form. | C21H18F3NO3S2 |
Mol. Mass. | 453.498 |
SMILES | Cc1nc(sc1CSc1ccc(OCC(O)=O)c(C)c1)-c1ccc(cc1)C(F)(F)F |
Structure |
|