| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Peroxisome proliferator-activated receptor delta |
|---|
| Ligand | BDBM28706 |
|---|
| Substrate/Competitor | BDBM10852 |
|---|
| Meas. Tech. | Cell-Based Transcription Assay |
|---|
| EC50 | 2830±n/a nM |
|---|
| Citation |  Sierra, ML; Beneton, V; Boullay, AB; Boyer, T; Brewster, AG; Donche, F; Forest, MC; Fouchet, MH; Gellibert, FJ; Grillot, DA; Lambert, MH; Laroze, A; Le Grumelec, C; Linget, JM; Montana, VG; Nguyen, VL; Nicodème, E; Patel, V; Penfornis, A; Pineau, O; Pohin, D; Potvain, F; Poulain, G; Ruault, CB; Saunders, M; Toum, J; Xu, HE; Xu, RX; Pianetti, PM Substituted 2-[(4-aminomethyl)phenoxy]-2-methylpropionic acid PPARalpha agonists. 1. Discovery of a novel series of potent HDLc raising agents. J Med Chem50:685-95 (2007) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Solution Info, Assay Method |
|---|
| |
| Peroxisome proliferator-activated receptor delta |
|---|
| Name: | Peroxisome proliferator-activated receptor delta |
|---|
| Synonyms: | NR1C2 | NUC1 | NUCI | Nuclear hormone receptor 1 | Nuclear receptor subfamily 1 group C member 2 | PPAR delta | PPAR-beta | PPARB | PPARD | PPARD_HUMAN | Peroxisome proliferator-activated receptor | Peroxisome proliferator-activated receptor beta | Peroxisome proliferator-activated receptor delta |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 49910.45 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | Q03181 |
|---|
| Residue: | 441 |
|---|
| Sequence: | MEQPQEEAPEVREEEEKEEVAEAEGAPELNGGPQHALPSSSYTDLSRSSSPPSLLDQLQM
GCDGASCGSLNMECRVCGDKASGFHYGVHACEGCKGFFRRTIRMKLEYEKCERSCKIQKK
NRNKCQYCRFQKCLALGMSHNAIRFGRMPEAEKRKLVAGLTANEGSQYNPQVADLKAFSK
HIYNAYLKNFNMTKKKARSILTGKASHTAPFVIHDIETLWQAEKGLVWKQLVNGLPPYKE
ISVHVFYRCQCTTVETVRELTEFAKSIPSFSSLFLNDQVTLLKYGVHEAIFAMLASIVNK
DGLLVANGSGFVTREFLRSLRKPFSDIIEPKFEFAVKFNALELDDSDLALFIAAIILCGD
RPGLMNVPRVEAIQDTILRALEFHLQANHPDAQYLFPKLLQKMADLRQLVTEHAQMMQRI
KKTETETSLHPLLQEIYKDMY
|
|
|
|---|
| BDBM28706 |
|---|
| BDBM10852 |
|---|
| Name | BDBM28706 |
|---|
| Synonyms: | 2-methyl-2-phenoxypropanoic acid, 25a | 2-methyl-2-{4-[({4-methyl-2-[4-(trifluoromethyl)phenyl]-1,3-thiazol-5-yl}formamido)methyl]phenoxy}propanoic acid | CHEMBL219586 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C23H21F3N2O4S |
|---|
| Mol. Mass. | 478.484 |
|---|
| SMILES | Cc1nc(sc1C(=O)NCc1ccc(OC(C)(C)C(O)=O)cc1)-c1ccc(cc1)C(F)(F)F |
|---|
| Structure | 
|
|---|
Search and Browse
