| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Peroxisome proliferator-activated receptor alpha |
|---|
| Ligand | BDBM28759 |
|---|
| Substrate/Competitor | BDBM10852 |
|---|
| Meas. Tech. | Cell-Based Transcription Assay |
|---|
| EC50 | 260±60 nM |
|---|
| Comments | 120 +/- 11 % of maximal activation compared to Wy 14,643 normalized to 100%. |
|---|
| Citation |  Montanari, R; Saccoccia, F; Scotti, E; Crestani, M; Godio, C; Gilardi, F; Loiodice, F; Fracchiolla, G; Laghezza, A; Tortorella, P; Lavecchia, A; Novellino, E; Mazza, F; Aschi, M; Pochetti, G Crystal structure of the peroxisome proliferator-activated receptor gamma (PPARgamma) ligand binding domain complexed with a novel partial agonist: a new region of the hydrophobic pocket could be exploited for drug design. J Med Chem51:7768-76 (2008) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Solution Info, Assay Method |
|---|
| |
| Peroxisome proliferator-activated receptor alpha |
|---|
| Name: | Peroxisome proliferator-activated receptor alpha |
|---|
| Synonyms: | Nr1c1 | Nuclear receptor subfamily 1 group C member 1 | PPAR-alpha | PPARA_MOUSE | Peroxisome Proliferator-Activated Receptor alpha | Ppar | Ppara |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 52343.28 |
|---|
| Organism: | Mus musculus |
|---|
| Description: | ChEMBL_572395 |
|---|
| Residue: | 468 |
|---|
| Sequence: | MVDTESPICPLSPLEADDLESPLSEEFLQEMGNIQEISQSIGEESSGSFGFADYQYLGSC
PGSEGSVITDTLSPASSPSSVSCPVIPASTDESPGSALNIECRICGDKASGYHYGVHACE
GCKGFFRRTIRLKLVYDKCDRSCKIQKKNRNKCQYCRFHKCLSVGMSHNAIRFGRMPRSE
KAKLKAEILTCEHDLKDSETADLKSLGKRIHEAYLKNFNMNKVKARVILAGKTSNNPPFV
IHDMETLCMAEKTLVAKMVANGVEDKEAEVRFFHCCQCMSVETVTELTEFAKAIPGFANL
DLNDQVTLLKYGVYEAIFTMLSSLMNKDGMLIAYGNGFITREFLKNLRKPFCDIMEPKFD
FAMKFNALELDDSDISLFVAAIICCGDRPGLLNIGYIEKLQEGIVHVLKLHLQSNHPDDT
FLFPKLLQKMVDLRQLVTEHAQLVQVIKKTESDAALHPLLQEIYRDMY
|
|
|
|---|
| BDBM28759 |
|---|
| BDBM10852 |
|---|
| Name | BDBM28759 |
|---|
| Synonyms: | (2S)-3-phenyl-2-(4-phenylphenoxy)propanoic acid | CHEMBL191275 | LT175 (S-1) |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C21H18O3 |
|---|
| Mol. Mass. | 318.3658 |
|---|
| SMILES | OC(=O)[C@H](Cc1ccccc1)Oc1ccc(cc1)-c1ccccc1 |r| |
|---|
| Structure | 
|
|---|
Search and Browse
