Reaction Details |
| Report a problem with these data |
Target | Mitogen-activated protein kinase 8 |
---|
Ligand | BDBM29281 |
---|
Substrate/Competitor | Biotin-labeled pepJIP1 |
---|
Meas. Tech. | DELFIA Assay (Dissociation Enhanced Lanthanide Fluoro-Immuno Assay) |
---|
pH | 7.8±n/a |
---|
Temperature | 273.15±n/a K |
---|
Comments | No displacement at 100 uM. |
---|
Citation | De, SK; Stebbins, JL; Chen, LH; Riel-Mehan, M; Machleidt, T; Dahl, R; Yuan, H; Emdadi, A; Barile, E; Chen, V; Murphy, R; Pellecchia, M Design, synthesis, and structure-activity relationship of substrate competitive, selective, and in vivo active triazole and thiadiazole inhibitors of the c-Jun N-terminal kinase. J Med Chem52:1943-52 (2009) [PubMed] Article |
---|
More Info.: | Get all data from this article, Solution Info, Assay Method |
---|
|
Mitogen-activated protein kinase 8 |
---|
Name: | Mitogen-activated protein kinase 8 |
Synonyms: | JNK-46 | JNK1 | JNK1-alpha-1 | MAPK8 | MK08_HUMAN | Mitogen-Activated Protein Kinase 8 (JNK1) | PRKM8 | SAPK1 | SAPK1C | Stress-activated protein kinase JNK1 | c-Jun N-terminal kinase 1 | c-Jun N-terminal kinase 1 (JNK1) | c-Jun N-terminal kinase 1(JNK1) | c-Jun N-terminal kinase 2 (JNK2) |
Type: | Enzyme |
Mol. Mass.: | 48297.57 |
Organism: | Homo sapiens (Human) |
Description: | JNK-1 was purchased from Upstate Cell Signaling Solutions (formerly Upstate Biotechnology). |
Residue: | 427 |
Sequence: | MSRSKRDNNFYSVEIGDSTFTVLKRYQNLKPIGSGAQGIVCAAYDAILERNVAIKKLSRP
FQNQTHAKRAYRELVLMKCVNHKNIIGLLNVFTPQKSLEEFQDVYIVMELMDANLCQVIQ
MELDHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAGTSF
MMTPYVVTRYYRAPEVILGMGYKENVDLWSVGCIMGEMVCHKILFPGRDYIDQWNKVIEQ
LGTPCPEFMKKLQPTVRTYVENRPKYAGYSFEKLFPDVLFPADSEHNKLKASQARDLLSK
MLVIDASKRISVDEALQHPYINVWYDPSEAEAPPPKIPDKQLDEREHTIEEWKELIYKEV
MDLEERTKNGVIRGQPSPLGAAVINGSQHPSSSSSVNDVSSMSTDPTLASDTDSSLEAAA
GPLGCCR
|
|
|
BDBM29281 |
---|
Biotin-labeled pepJIP1 |
---|
Name: | Biotin-labeled pepJIP1 |
Synonyms: | biotinylated peptide derived from JNK-interacting protein 1. |
Type: | Peptide |
Mol. Mass.: | 2132.62 |
Organism: | n/a |
Description: | lc indicates a hydrocarbon chain of six methylene groups was added. |
Residue: | 18 |
Sequence: | |