Reaction Details |
| Report a problem with these data |
Target | Dimer of Gag-Pol polyprotein [489-587] |
---|
Ligand | BDBM549 |
---|
Substrate/Competitor | Peptide Substrate |
---|
Meas. Tech. | Protease Inhibition Assay |
---|
pH | 5±n/a |
---|
Temperature | 295.15±n/a K |
---|
Ki | 0.12±n/a nM |
---|
Citation | Thaisrivongs, S; Skulnick, HI; Turner, SR; Strohbach, JW; Tommasi, RA; Johnson, PD; Aristoff, PA; Judge, TM; Gammill, RB; Morris, JK; Romines, KR; Chrusciel, RA; Hinshaw, RR; Chong, KT; Tarpley, WG; Poppe, SM; Slade, DE; Lynn, JC; Horng, MM; Tomich, PK; Seest, EP; Dolak, LA; Howe, WJ; Howard, GM; Watenpaugh, KD Structure-based design of HIV protease inhibitors: sulfonamide-containing 5,6-dihydro-4-hydroxy-2-pyrones as non-peptidic inhibitors. J Med Chem39:4349-53 (1996) [PubMed] Article |
---|
More Info.: | Get all data from this article, Solution Info, Assay Method |
---|
|
Dimer of Gag-Pol polyprotein [489-587] |
---|
Name: | Dimer of Gag-Pol polyprotein [489-587] |
Synonyms: | HIV-1 Protease |
Type: | Tandem linked enzyme construct |
Mol. Mass.: | n/a |
Description: | n/a |
Components: | This complex has 2 components. |
Component 1 |
Name: | Gag-Pol polyprotein [489-587] |
Synonyms: | Human immunodeficiency virus type 1 protease | POL_HV1H2 | Pol polyprotein | gag-pol |
Type: | Enzyme Subunit |
Mol. Mass.: | 10781.16 |
Organism: | Human immunodeficiency virus type 1 |
Description: | P04585[489-587] |
Residue: | 99 |
Sequence: | PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
Component 2 |
Name: | Gag-Pol polyprotein [489-587] |
Synonyms: | Human immunodeficiency virus type 1 protease | POL_HV1H2 | Pol polyprotein | gag-pol |
Type: | Enzyme Subunit |
Mol. Mass.: | 10781.16 |
Organism: | Human immunodeficiency virus type 1 |
Description: | P04585[489-587] |
Residue: | 99 |
Sequence: | PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
BDBM549 |
---|
Peptide Substrate |
---|
Name: | Peptide Substrate |
Synonyms: | n/a |
Type: | Peptide |
Mol. Mass.: | 1447.64 |
Organism: | n/a |
Description: | The peptide was derivatized with biotin and
fluorescein isothiocyanate at the amino and carboxy termini. |
Residue: | 12 |
Sequence: | |