| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Ribosyldihydronicotinamide dehydrogenase [quinone] |
|---|
| Ligand | BDBM23926 |
|---|
| Substrate/Competitor | BDBM29211 |
|---|
| Meas. Tech. | QR2 Inhibition Assay |
|---|
| pH | 8±n/a |
|---|
| Temperature | 298.15±n/a K |
|---|
| IC50 | 960±130 nM |
|---|
| Citation |  Calamini, B; Santarsiero, BD; Boutin, JA; Mesecar, AD Kinetic, thermodynamic and X-ray structural insights into the interaction of melatonin and analogues with quinone reductase 2. Biochem J413:81-91 (2008) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Inhibition_Run data, Solution Info, Assay Method |
|---|
| |
| Ribosyldihydronicotinamide dehydrogenase [quinone] |
|---|
| Name: | Ribosyldihydronicotinamide dehydrogenase [quinone] |
|---|
| Synonyms: | Metallothionein-3 | NMOR2 | NQO2 | NQO2_HUMAN | NRH dehydrogenase [quinone] 2 | NRH:quinone oxidoreductase 2 | QR2 | Quinone reductase 2 | Quinone reductase 2 (NQO2) | Ribosyldihydronicotinamide dehydrogenase [quinone] |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 25917.25 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P16083 |
|---|
| Residue: | 231 |
|---|
| Sequence: | MAGKKVLIVYAHQEPKSFNGSLKNVAVDELSRQGCTVTVSDLYAMNLEPRATDKDITGTL
SNPEVFNYGVETHEAYKQRSLASDITDEQKKVREADLVIFQFPLYWFSVPAILKGWMDRV
LCQGFAFDIPGFYDSGLLQGKLALLSVTTGGTAEMYTKTGVNGDSRYFLWPLQHGTLHFC
GFKVLAPQISFAPEIASEEERKGMVAAWSQRLQTIWKEEPIPCTAHWHFGQ
|
|
|
|---|
| BDBM23926 |
|---|
| BDBM29211 |
|---|
| Name | BDBM23926 |
|---|
| Synonyms: | (E)-resveratrol | 5-[(E)-2-(4-hydroxyphenyl)ethenyl]benzene-1,3-diol | CHEMBL165 | Resveratol | Stilbene, 2f | US11866416, Example 7 | cid_445154 | resveratrol | trans-resveratrol |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C14H12O3 |
|---|
| Mol. Mass. | 228.2433 |
|---|
| SMILES | Oc1ccc(\C=C\c2cc(O)cc(O)c2)cc1 |
|---|
| Structure | 
|
|---|
Search and Browse
