| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Nociceptin receptor |
|---|
| Ligand | BDBM29995 |
|---|
| Substrate/Competitor | BDBM29961 |
|---|
| Meas. Tech. | In Vitro Binding Assay (IC50) and In Vitro Agonism/Antagonism Measurements (EC50/IC50) |
|---|
| pH | 7.4±n/a |
|---|
| Temperature | 310.15±n/a K |
|---|
| IC50 | 2.6±n/a nM |
|---|
| EC50 | 0.65±n/a nM |
|---|
| Citation |  Kobayashi, K; Kato, T; Yamamoto, I; Shimizu, A; Mizutani, S; Asai, M; Kawamoto, H; Ito, S; Yoshizumi, T; Hirayama, M; Ozaki, S; Ohta, H; Okamoto, O Optimization of benzimidazole series as opioid receptor-like 1 (ORL1) antagonists: SAR study directed toward improvement of selectivity over hERG activity. Bioorg Med Chem Lett19:3100-3 (2009) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Solution Info, Assay Method |
|---|
| |
| Nociceptin receptor |
|---|
| Name: | Nociceptin receptor |
|---|
| Synonyms: | KOR-3 | Kappa-type 3 opioid receptor | Mu-type opioid receptor (Mu) | NOP | Nociceptin Receptor (ORL1 Receptor) | Nociceptin receptor (NOP) | Nociceptin receptor (ORL-1) | Nociceptin receptor (ORL1) | Nociceptin/Orphanin FQ, NOP receptor | OOR | OPIATE ORL-1 | OPRL1 | OPRL1 protein | OPRX_HUMAN | ORL1 | ORL1 receptor | Opioid receptor like-1 | Orphanin FQ receptor | Orphanin FQ receptor (ORL1) | P41146 |
|---|
| Type: | G Protein-Coupled Receptor (GPCR) |
|---|
| Mol. Mass.: | 40702.87 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P41146 |
|---|
| Residue: | 370 |
|---|
| Sequence: | MEPLFPAPFWEVIYGSHLQGNLSLLSPNHSLLPPHLLLNASHGAFLPLGLKVTIVGLYLA
VCVGGLLGNCLVMYVILRHTKMKTATNIYIFNLALADTLVLLTLPFQGTDILLGFWPFGN
ALCKTVIAIDYYNMFTSTFTLTAMSVDRYVAICHPIRALDVRTSSKAQAVNVAIWALASV
VGVPVAIMGSAQVEDEEIECLVEIPTPQDYWGPVFAICIFLFSFIVPVLVISVCYSLMIR
RLRGVRLLSGSREKDRNLRRITRLVLVVVAVFVGCWTPVQVFVLAQGLGVQPSSETAVAI
LRFCTALGYVNSCLNPILYAFLDENFKACFRKFCCASALRRDVQVSDRVRSIAKDVALAC
KTSETVPRPA
|
|
|
|---|
| BDBM29995 |
|---|
| BDBM29961 |
|---|
| Name | BDBM29995 |
|---|
| Synonyms: | CHEMBL494350 | benzimidazole-based antagonist, 1 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C18H27ClN4OS |
|---|
| Mol. Mass. | 382.951 |
|---|
| SMILES | C[C@@H]1CN(CCO)CCN1c1cc2[nH]c(SC(C)(C)C)nc2cc1Cl |r| |
|---|
| Structure | 
|
|---|
Search and Browse
