Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetD-amino-acid oxidase
LigandBDBM31150
Substrate/CompetitorBDBM23167
Meas. Tech.DAAO in Vitro Activity Assay
pH8.5±n/a
Temperature295.15±n/a K
IC50 10±n/a nM
Citation Duplantier AJBecker SLBohanon MJBorzilleri KAChrunyk BADowns JTHu LYEl-Kattan AJames LCLiu SLu JMaklad NMansour MNMente SPiotrowski MASakya SMSheehan SSteyn SJStrick CAWilliams VAZhang L Discovery, SAR, and pharmacokinetics of a novel 3-hydroxyquinolin-2(1H)-one series of potent D-amino acid oxidase (DAAO) inhibitors. J Med Chem 52:3576-85 (2009) [PubMed]  Article
More Info.:Get all data from this article,  Inhibition_Run data,   Solution Info,  Assay Method
 
D-amino-acid oxidase
Name:D-amino-acid oxidase
Synonyms:D-amino-acid oxidase (DAAO) | DAAO | DAMOX | DAO
Type:Homodimer
Mol. Mass.:39476.06
Organism:Homo sapiens (Human)
Description:n/a
Residue:347
Sequence:
MRVVVIGAGVIGLSTALCIHERYHSVLQPLDIKVYADRFTPLTTTDVAAGLWQPYLSDPN
NPQEADWSQQTFDYLLSHVHSPNAENLGLFLISGYNLFHEAIPDPSWKDTVLGFRKLTPR
ELDMFPDYGYGWFHTSLILEGKNYLQWLTERLTERGVKFFQRKVESFEEVAREGADVIVN
CTGVWAGALQRDPLLQPGRGQIMKVDAPWMKHFILTHDPERGIYNSPYIIPGTQTVTLGG
IFQLGNWSELNNIQDHNTIWEGCCRLEPTLKNARIIGERTGFRPVRPQIRLEREQLRTGP
SNTEVIHNYGHGGYGLTIHWGCALEAAKLFGRILEEKKLSRMPPSHL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM31150
BDBM23167
NameBDBM31150
Synonyms:3-hydroxyquinolin-2(1H)-one, 4
TypeSmall organic molecule
Emp. Form.C9H6FNO2
Mol. Mass.179.1478
SMILESOc1cc2ccc(F)cc2[nH]c1=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: