Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetD-Aspartate Oxidase (DDO)
LigandBDBM31147
Substrate/CompetitorBDBM31174
Meas. Tech.DAAO in Vitro Activity Assay
IC50>19500±n/a nM
Citation Duplantier AJBecker SLBohanon MJBorzilleri KAChrunyk BADowns JTHu LYEl-Kattan AJames LCLiu SLu JMaklad NMansour MNMente SPiotrowski MASakya SMSheehan SSteyn SJStrick CAWilliams VAZhang L Discovery, SAR, and pharmacokinetics of a novel 3-hydroxyquinolin-2(1H)-one series of potent D-amino acid oxidase (DAAO) inhibitors. J Med Chem 52:3576-85 (2009) [PubMed]  Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
D-Aspartate Oxidase (DDO)
Name:D-Aspartate Oxidase (DDO)
Synonyms:DASOX
Type:Oxidoreductase
Mol. Mass.:37543.06
Organism:Homo sapiens (Human)
Description:Recombinant human DDO expressed and purified from sf9 insect cells, was used in enzyme assays.
Residue:341
Sequence:
MDTARIAVVGAGVVGLSTAVCISKLVPRCSVTIISDKFTPDTTSDVAAGMLIPHTYPDTP
IHTQKQWFRETFNHLFAIANSAEAGDAGVHLVSGWQIFQSTPTEEVPFWADVVLGFRKMT
EAELKKFPQYVFGQAFTTLKCECPAYLPWLEKRIKGSGGWTLTRRIEDLWELHPSFDIVV
NCSGLGSRQLAGDSKIFPVRGQVLQVQAPWVEHFIRDGSGLTYIYPGTSHVTLGGTRQKG
DWNLSPDAENSREILSRCCALEPSLHGACNIREKVGLRPYRPGVRLQTELLARDGQRLPV
VHHYGHGSGGISVHWGTALEAARLVSECVHALRTPIPKSNL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM31147
BDBM31174
NameBDBM31147
Synonyms:4H-furo[3,2-b]pyrrole-5-carboxylic acid | 5-carboxyfuro[3,2-b]pyrrole, 1 | CHEMBL492591
TypeSmall organic molecule
Emp. Form.C7H5NO3
Mol. Mass.151.1195
SMILESOC(=O)c1cc2occc2[nH]1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: