Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetD-amino-acid oxidase
LigandBDBM31151
Substrate/CompetitorBDBM10852
Meas. Tech.Biacore Binding of DAAO Inhibitors
Kd 17±n/a nM
Citation Duplantier AJBecker SLBohanon MJBorzilleri KAChrunyk BADowns JTHu LYEl-Kattan AJames LCLiu SLu JMaklad NMansour MNMente SPiotrowski MASakya SMSheehan SSteyn SJStrick CAWilliams VAZhang L Discovery, SAR, and pharmacokinetics of a novel 3-hydroxyquinolin-2(1H)-one series of potent D-amino acid oxidase (DAAO) inhibitors. J Med Chem 52:3576-85 (2009) [PubMed]  Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
D-amino-acid oxidase
Name:D-amino-acid oxidase
Synonyms:D-amino-acid oxidase (DAAO) | DAAO | DAMOX | DAO
Type:Homodimer
Mol. Mass.:39476.06
Organism:Homo sapiens (Human)
Description:n/a
Residue:347
Sequence:
MRVVVIGAGVIGLSTALCIHERYHSVLQPLDIKVYADRFTPLTTTDVAAGLWQPYLSDPN
NPQEADWSQQTFDYLLSHVHSPNAENLGLFLISGYNLFHEAIPDPSWKDTVLGFRKLTPR
ELDMFPDYGYGWFHTSLILEGKNYLQWLTERLTERGVKFFQRKVESFEEVAREGADVIVN
CTGVWAGALQRDPLLQPGRGQIMKVDAPWMKHFILTHDPERGIYNSPYIIPGTQTVTLGG
IFQLGNWSELNNIQDHNTIWEGCCRLEPTLKNARIIGERTGFRPVRPQIRLEREQLRTGP
SNTEVIHNYGHGGYGLTIHWGCALEAAKLFGRILEEKKLSRMPPSHL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM31151
BDBM10852
NameBDBM31151
Synonyms:3-hydroxyquinolin-2(1H)-one, 5
TypeSmall organic molecule
Emp. Form.C9H6FNO2
Mol. Mass.179.1478
SMILESOc1cc2cc(F)ccc2[nH]c1=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: