Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetD-Amino Acid Oxidase (DAAO)
LigandBDBM31156
Substrate/CompetitorBDBM23167
Meas. Tech.DAAO in Vitro Activity Assay
IC50 40±n/a nM
Citation Duplantier AJBecker SLBohanon MJBorzilleri KAChrunyk BADowns JTHu LYEl-Kattan AJames LCLiu SLu JMaklad NMansour MNMente SPiotrowski MASakya SMSheehan SSteyn SJStrick CAWilliams VAZhang L Discovery, SAR, and pharmacokinetics of a novel 3-hydroxyquinolin-2(1H)-one series of potent D-amino acid oxidase (DAAO) inhibitors. J Med Chem 52:3576-85 (2009) [PubMed]  Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
D-Amino Acid Oxidase (DAAO)
Name:D-Amino Acid Oxidase (DAAO)
Synonyms:DAMOX | DAO
Type:Homodimer
Mol. Mass.:38824.91
Organism:Rattus norvegicus (rat)
Description:Recombinant rat DAAO expressed and purified from sf9 insect cells, was used in enzyme assays.
Residue:346
Sequence:
MRVAVIGAGVIGLSTALCIHERYHPAQPLHMKIYADRFTPFTTSDVAAGLWQPYLSDPSN
PQEAEWNQQTFDHLQSCLHSPNAEKMGLALISGYNLFRDEVPDPFWKSTVLGFRKLTPSE
LDMFPDYSYGWFNTSLLLEGKSYLSWLTERLTERGVKFIHRKVASFEEVVRGGVDVIINC
TGVWAGALQADASLQPGRGQIIQVEAPWIKHFILTHDPSLGIYNSPYIIPGSKTVTLGGV
FQLGNWSELNSVHDHNTIWKSCCQLEPTLKNARIMGELTGFRPVRPQVRLERERLRFGSS
SAEVIHNYGHGGYGLTIHWGCAMEAANLFGKILEEKNLSRMPPSHL
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM31156
BDBM23167
NameBDBM31156
Synonyms:3-hydroxyquinolin-2(1H)-one, 10
TypeSmall organic molecule
Emp. Form.C9H6ClNO2
Mol. Mass.195.602
SMILESOc1cc2c(Cl)cccc2[nH]c1=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: