Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetRunt-Related Transcription Factor 1 Isoform AML1C
LigandBDBM31183
Substrate/CompetitorVenus-CBFbeta-SMMHC
Meas. Tech.FRET Assay
pH7.5±n/a
Temperature296.15±n/a K
IC50 1100±140 nM
Citation Gorczynski MJGrembecka JZhou YKong YRoudaia LDouvas MGNewman MBielnicka IBaber GCorpora TShi JSridharan MLilien RDonald BRSpeck NABrown MLBushweller JH Allosteric inhibition of the protein-protein interaction between the leukemia-associated proteins Runx1 and CBFbeta. Chem Biol 14:1186-97 (2007) [PubMed]  Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Runt-Related Transcription Factor 1 Isoform AML1C
Name:Runt-Related Transcription Factor 1 Isoform AML1C
Synonyms:Acute myeloid leukemia 1 protein | CBF-alpha-2 | Core-binding factor subunit alpha-2 | Oncogene AML-1 | Polyomavirus enhancer-binding protein 2 alpha B subunit
Type:Subunit of heterodimeric transcription factor
Mol. Mass.:48750.25
Organism:Homo sapiens (Human)
Description:Q01196
Residue:453
Sequence:
MRIPVDASTSRRFTPPSTALSPGKMSEALPLGAPDAGAALAGKLRSGDRSMVEVLADHPG
ELVRTDSPNFLCSVLPTHWRCNKTLPIAFKVVALGDVPDGTLVTVMAGNDENYSAELRNA
TAAMKNQVARFNDLRFVGRSGRGKSFTLTITVFTNPPQVATYHRAIKITVDGPREPRRHR
QKLDDQTKPGSLSFSERLSELEQLRRTAMRVSPHHPAPTPNPRASLNHSTAFNPQPQSQM
QDTRQIQPSPPWSYDQSYQYLGSIASPSVHPATPISPGRASGMTTLSAELSSRLSTAPDL
TAFSDPRQFPALPSISDPRMHYPGAFTYSPTPVTSGIGIGMSAMGSATRYHTYLPPPYPG
SSQAQGGPFQASSPSYHLYYGASAGSYQFSMVGGERSPPRILPPCTNASTGSALLNPSLP
NQSDVVEAEGSHSNSPTNMAPSARLEEAVWRPY
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM31183
Venus-CBFbeta-SMMHC
Name:Venus-CBFbeta-SMMHC
Synonyms:CBFbeta | Core-binding factor subunit beta isoform 2 | Venus-core-binding factor subunit beta-smooth muscle myosin heavy chain
Type:Fluorescent fusion protein
Mol. Mass.:21988.19
Organism:Homo sapiens (Human)
Description:Venus-CBFbeta-SMMHC was provided by Dr. John Bushweller (University of Virginia Charlottesville, Charlottesville VA). Only the amino acid sequence of core-binding factor subunit beta (CBFbeta) isoform 2 is shown here.
Residue:187
Sequence:
MPRVVPDQRSKFENEEFFRKLSRECEIKYTGFRDRPHEERQARFQNACRDGRSEIAFVAT
GTNLSLQFFPASWQGEQRQTPSREYVDLEREAGKVYLKAPMILNGVCVIWKGWIDLQRLD
GMGCLEFDEERAQQEDALAQQAFEEARRRTREFEDRDRSHREEMEARRQQDPSPGSNLGG
GDDLKLR
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff: