| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Dimer of Gag-Pol polyprotein [501-599,Q508K,L534I,L564I,C568A,C596A] |
|---|
| Ligand | BDBM31813 |
|---|
| Substrate/Competitor | HIV Protease Substrate |
|---|
| Meas. Tech. | Protease Inhibition Assay |
|---|
| pH | 6.4±n/a |
|---|
| Temperature | 298.15±n/a K |
|---|
| Ki | 0.31±.03 nM |
|---|
| Citation |  Ghosh, AK; Leshchenko-Yashchuk, S; Anderson, DD; Baldridge, A; Noetzel, M; Miller, HB; Tie, Y; Wang, YF; Koh, Y; Weber, IT; Mitsuya, H Design of HIV-1 protease inhibitors with pyrrolidinones and oxazolidinones as novel P1'-ligands to enhance backbone-binding interactions with protease: synthesis, biological evaluation, and protein-ligand X-ray studies. J Med Chem52:3902-14 (2009) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Solution Info, Assay Method |
|---|
| |
| Dimer of Gag-Pol polyprotein [501-599,Q508K,L534I,L564I,C568A,C596A] |
|---|
| Name: | Dimer of Gag-Pol polyprotein [501-599,Q508K,L534I,L564I,C568A,C596A] |
|---|
| Synonyms: | HIV-1 Protease |
|---|
| Type: | Protein Complex |
|---|
| Mol. Mass.: | n/a |
|---|
| Description: | n/a |
|---|
| Components: | This complex has 2 components. |
|---|
| Component 1 |
| Name: | Gag-Pol polyprotein [501-599,Q508K,L534I,L564I,C568A,C596A] |
|---|
| Synonyms: | HIV-1 Protease chain A | POL_HV1BR | gag-pol |
|---|
| Type: | Enzyme Subunit |
|---|
| Mol. Mass.: | 10732.11 |
|---|
| Organism: | Human immunodeficiency virus type 1 |
|---|
| Description: | The HIV-1 protease (Genbank HIVHXB2CG) clone was constructed with the substitutions Q7K, L33I, and L63I, to minimize the autoproteolysis of the protease, and C67A and C95A, to prevent cysteine-thiol oxidation. |
|---|
| Residue: | 99 |
|---|
| Sequence: | PQITLWKRPLVTIKIGGQLKEALLDTGADDTVIEEMSLPGRWKPKMIGGIGGFIKVRQYD
QIIIEIAGHKAIGTVLVGPTPVNIIGRNLLTQIGATLNF
|
|
|
|---|
| Component 2 |
| Name: | Gag-Pol polyprotein [501-599,Q508K,L534I,L564I,C568A,C596A] |
|---|
| Synonyms: | HIV-1 Protease chain A | POL_HV1BR | gag-pol |
|---|
| Type: | Enzyme Subunit |
|---|
| Mol. Mass.: | 10732.11 |
|---|
| Organism: | Human immunodeficiency virus type 1 |
|---|
| Description: | The HIV-1 protease (Genbank HIVHXB2CG) clone was constructed with the substitutions Q7K, L33I, and L63I, to minimize the autoproteolysis of the protease, and C67A and C95A, to prevent cysteine-thiol oxidation. |
|---|
| Residue: | 99 |
|---|
| Sequence: | PQITLWKRPLVTIKIGGQLKEALLDTGADDTVIEEMSLPGRWKPKMIGGIGGFIKVRQYD
QIIIEIAGHKAIGTVLVGPTPVNIIGRNLLTQIGATLNF
|
|
|
|---|
| BDBM31813 |
|---|
| HIV Protease Substrate |
|---|
| Name: | HIV Protease Substrate |
|---|
| Synonyms: | n/a |
|---|
| Type: | Fluorogenic peptide |
|---|
| Mol. Mass.: | 3467.28 |
|---|
| Organism: | n/a |
|---|
| Description: | n/a |
|---|
| Residue: | 30 |
|---|
| Sequence: | 2-(aminobenzoyl)-Thr-Ile-Nle-Phe(p-NO2)-Gln-ArgNH2
|
|
|
|---|
Search and Browse
