Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetEGF-R Tyrosine Kinase
LigandBDBM4567
Substrate/CompetitorTyr 04 Substrate Peptide
Meas. Tech.EGFR IC50 Determination
pH7.5±n/a
Temperature296.15±n/a K
IC50 0.08±n/a nM
Citation Michalczyk AKlüter SRode HBSimard JRGrütter CRabiller MRauh D Structural insights into how irreversible inhibitors can overcome drug resistance in EGFR. Bioorg Med Chem 16:3482-8 (2008) [PubMed]  Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
EGF-R Tyrosine Kinase
Name:EGF-R Tyrosine Kinase
Synonyms:Epidermal growth factor receptor (EGFR) | Receptor tyrosine-protein kinase ErbB-1
Type:Cytoplasmic region
Mol. Mass.:61304.06
Organism:Homo sapiens (Human)
Description:Wildtype EGFR was purchased from Invitrogen.
Residue:543
Sequence:
MRRRHIVRKRTLRRLLQERELVEPLTPSGEAPNQALLRILKETEFKKIKVLGSGAFGTVY
KGLWIPEGEKVKIPVAIKELREATSPKANKEILDEAYVMASVDNPHVCRLLGICLTSTVQ
LITQLMPFGCLLDYVREHKDNIGSQYLLNWCVQIAKGMNYLEDRRLVHRDLAARNVLVKT
PQHVKITDFGLAKLLGAEEKEYHAEGGKVPIKWMALESILHRIYTHQSDVWSYGVTVWEL
MTFGSKPYDGIPASEISSILEKGERLPQPPICTIDVYMIMVKCWMIDADSRPKFRELIIE
FSKMARDPQRYLVIQGDERMHLPSPTDSNFYRALMDEEDMDDVVDADEYLIPQQGFFSSP
STSRTPLLSSLSATSNNSTVACIDRNGLQSCPIKEDSFLQRYSSDPTGALTEDSIDDTFL
PVPEYINQSVPKRPAGSVQNPVYHNQPLNPAPSRDPHYQDPHSTAVGNPEYLNTVQPTCV
NSTFDSPAHWAQKGSHQISLDNPDYQQDFFPKEAKPNGIFKGSTAENAEYLRVAPQSSEF
IGA
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM4567
Tyr 04 Substrate Peptide
Name:Tyr 04 Substrate Peptide
Synonyms:n/a
Type:FRET-peptide substrate
Mol. Mass.:358.43
Organism:n/a
Description:n/a
Residue:3
Sequence:
n/a