| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Proto-oncogene tyrosine-protein kinase Src [251-533,S345C] |
|---|
| Ligand | BDBM4583 |
|---|
| Substrate/Competitor | Tyr 02 Substrate Peptide |
|---|
| Meas. Tech. | Src IC50 Determination |
|---|
| pH | 7.5±n/a |
|---|
| Temperature | 296.15±n/a K |
|---|
| IC50 | 236±n/a nM |
|---|
| Citation |  Michalczyk, A; Klüter, S; Rode, HB; Simard, JR; Grütter, C; Rabiller, M; Rauh, D Structural insights into how irreversible inhibitors can overcome drug resistance in EGFR. Bioorg Med Chem16:3482-8 (2008) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Solution Info, Assay Method |
|---|
| |
| Proto-oncogene tyrosine-protein kinase Src [251-533,S345C] |
|---|
| Name: | Proto-oncogene tyrosine-protein kinase Src [251-533,S345C] |
|---|
| Synonyms: | Proto-oncogene tyrosine-protein kinase Src | SRC | SRC_CHICK | Src Mutant (S345C) | cSRC-SM |
|---|
| Type: | Tyr protein kinase |
|---|
| Mol. Mass.: | 32702.38 |
|---|
| Organism: | Gallus gallus (Chicken) |
|---|
| Description: | Mutation of S345 to cysteine was introduced by site-directed mutagenesis and confirmed by sequence analysis. |
|---|
| Residue: | 286 |
|---|
| Sequence: | GHMQTQGLAKDAWEIPRESLRLEVKLGQGCFGEVWMGTWNGTTRVAIKTLKPGTMSPEAF
LQEAQVMKKLRHEKLVQLYAVVSEEPIYIVTEYMSKGCLLDFLKGEMGKYLRLPQLVDMA
AQIASGMAYVERMNYVHRDLRAANILVGENLVCKVADFGLARLIEDNEYTARQGAKFPIK
WTAPEAALYGRFTIKSDVWSFGILLTELTTKGRVPYPGMVNREVLDQVERGYRMPCPPEC
PESLHDLMCQCWRKDPEERPTFEYLQAFLEDYFTSTEPQYQPGENL
|
|
|
|---|
| BDBM4583 |
|---|
| Tyr 02 Substrate Peptide |
|---|
| Name: | Tyr 02 Substrate Peptide |
|---|
| Synonyms: | n/a |
|---|
| Type: | FRET-peptide substrate |
|---|
| Mol. Mass.: | 358.43 |
|---|
| Organism: | n/a |
|---|
| Description: | n/a |
|---|
| Residue: | 3 |
|---|
| Sequence: | |
|---|
Search and Browse
