Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetRetinoic Acid Receptor, alpha
LigandBDBM31886
Substrate/CompetitorBDBM31883
Meas. Tech.Retinoid Competition Binding Assay
pH7.9±n/a
Temperature277.15±n/a K
Kd 118±n/a nM
Citation Klaholz BPMitschler AMoras D Structural basis for isotype selectivity of the human retinoic acid nuclear receptor. J Mol Biol 302:155-70 (2000) [PubMed]  Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
Retinoic Acid Receptor, alpha
Name:Retinoic Acid Receptor, alpha
Synonyms:Nuclear receptor subfamily 1 group B member 1 | RAR-alpha
Type:Ligand-binding domain
Mol. Mass.:24746.59
Organism:Homo sapiens (Human)
Description:n/a
Residue:220
Sequence:
PALCQLGKYTTNNSSEQRVSLDIDLWDKFSELSTKCIIKTVEFAKQLPGFTTLTIADQIT
LLKAACLDILILRICTRYTPEQDTMTFSDGLTLNRTQMHNAGFGPLTDLVFAFANQLLPL
EMDDAETGLLSAICLICGDRQDLEQPDRVDMLQEPLLEALKVYVRKRRPSRPHMFPKMLM
KITDLRSISAKGAERVITLKMEIPGSMPPLIQEMLENSEG
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM31886
BDBM31883
NameBDBM31886
Synonyms:CD564 | CHEMBL309282
TypeSmall organic molecule
Emp. Form.C26H26O3
Mol. Mass.386.4828
SMILESCC1(C)CCC(C)(C)c2cc(ccc12)C(=O)c1ccc2cc(ccc2c1)C(O)=O
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: