Reaction Details |
| Report a problem with these data |
Target | Retinoic acid receptor alpha [200-419] |
---|
Ligand | BDBM31890 |
---|
Substrate/Competitor | BDBM31883 |
---|
Meas. Tech. | Retinoid Competition Binding Assay |
---|
pH | 7.9±n/a |
---|
Temperature | 277.15±n/a K |
---|
Comments | No binding. |
---|
Citation | Klaholz, BP; Mitschler, A; Moras, D Structural basis for isotype selectivity of the human retinoic acid nuclear receptor. J Mol Biol302:155-70 (2000) [PubMed] Article |
---|
More Info.: | Get all data from this article, Solution Info, Assay Method |
---|
|
Retinoic acid receptor alpha [200-419] |
---|
Name: | Retinoic acid receptor alpha [200-419] |
Synonyms: | NR1B1 | Nuclear receptor subfamily 1 group B member 1 | RAR-alpha | RARA | RARA_HUMAN | Retinoic Acid Receptor, alpha |
Type: | Ligand-binding domain |
Mol. Mass.: | 24746.59 |
Organism: | Homo sapiens (Human) |
Description: | P10276[200-419] |
Residue: | 220 |
Sequence: | PALCQLGKYTTNNSSEQRVSLDIDLWDKFSELSTKCIIKTVEFAKQLPGFTTLTIADQIT
LLKAACLDILILRICTRYTPEQDTMTFSDGLTLNRTQMHNAGFGPLTDLVFAFANQLLPL
EMDDAETGLLSAICLICGDRQDLEQPDRVDMLQEPLLEALKVYVRKRRPSRPHMFPKMLM
KITDLRSISAKGAERVITLKMEIPGSMPPLIQEMLENSEG
|
|
|
BDBM31890 |
---|
BDBM31883 |
---|
Name | BDBM31890 |
Synonyms: | BMS270395 |
Type | Small organic molecule |
Emp. Form. | C23H26FNO4 |
Mol. Mass. | 399.4552 |
SMILES | CC1(C)CCC(C)(C)c2cc(ccc12)[C@H](O)C(=O)Nc1ccc(cc1F)C(O)=O |
Structure |
|